KEGG   Alteromonas sp. Mac1: AV939_10630Help
Entry
AV939_10630       CDS       T05687                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00020  Citrate cycle (TCA cycle)
ale00190  Oxidative phosphorylation
ale00650  Butanoate metabolism
ale01100  Metabolic pathways
ale01110  Biosynthesis of secondary metabolites
ale01120  Microbial metabolism in diverse environments
ale01130  Biosynthesis of antibiotics
ale01200  Carbon metabolism
Module
ale_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ale_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ale_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AV939_10630 (sdhB)
   00650 Butanoate metabolism
    AV939_10630 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AV939_10630 (sdhB)
Enzymes [BR:ale01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AV939_10630 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AV939_10630 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AMJ86986
LinkDB All DBs
Position
complement(2489552..2490262)
Genome map
AA seq 236 aa AA seqDB search
MQLQFSIYRYNPDVDNKPRMQDYTLEVEEGRDMMVLDALIALKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPLSALGKGKVVVRPLPGLPVVRDLVVDMTQFYTQYEKIKPFLI
NDDKQPPAREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
IDSRDTATDERLNDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLQRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacaattttcgatatatcgttacaaccctgatgttgataacaagccacgcatg
caagactacactctagaagtagaggaaggtcgtgacatgatggtgttggatgcacttatt
gctcttaaagagcaagatccaacgttatcattccgccgctcgtgccgtgaaggtgtgtgt
ggttcagacggtgtcaatatgaatggtaagaatggtcttgcctgcattacgccattgtct
gcattaggtaaaggtaaagttgttgttcgtccacttccaggtttgccagtagtacgcgac
cttgtggttgatatgacacaattttacacccagtatgaaaagattaagccattcttaatc
aacgatgataaacagcctcctgcaagagaacaccttcagtctcctgaagaacgtgctaag
cttgatgggctgtatgaatgtattctatgtgcatgttgttctacgtcgtgcccatcgttc
tggtggaacccggataaatttatcgggccagctggtttgcttcacgcttatcgtttcctt
atcgatagtcgtgatactgcaaccgacgaacgcttgaacgacctagatgacgcatttagc
gtattccgctgtcacggtatcatgaactgtgtaagtgtatgtccgaaaggattaaacccg
acaaaggcaattggacacattaagtctatgcttttacaacgggctgtttag

DBGET integrated database retrieval system