KEGG   Alteromonas sp. Mac1: AV939_10635Help
Entry
AV939_10635       CDS       T05687                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00020  Citrate cycle (TCA cycle)
ale00190  Oxidative phosphorylation
ale00650  Butanoate metabolism
ale01100  Metabolic pathways
ale01110  Biosynthesis of secondary metabolites
ale01120  Microbial metabolism in diverse environments
ale01130  Biosynthesis of antibiotics
ale01200  Carbon metabolism
Module
ale_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ale_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ale_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AV939_10635 (sdhA)
   00650 Butanoate metabolism
    AV939_10635 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AV939_10635 (sdhA)
Enzymes [BR:ale01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AV939_10635 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AV939_10635 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMJ86987
LinkDB All DBs
Position
complement(2490277..2492049)
Genome map
AA seq 590 aa AA seqDB search
MSLPVHEFDAVVIGAGGAGMRAALQISESGKSCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAIIEMENMGLPFSRFENGKVYQRPFG
GQSRNFGGEQAARTAAAADRTGHALLHLLYQQNVKNKTKVFSEWYALDLVKNQDGDVVGC
TAIDIETGEVVYFKSKAVVLATGGAGRIFASTTNAHINTGDGVGMAIRAGVALQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGFDGPWGPHCKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTTVDGQCLTVDADGNDKVVNGLFACGEIACVSVHGANRLGGNSLLDLVVFGRATGLHLG
KTLSDVSPFREASESDLEVAMSRFNRWENSEKGKGEDPVQIKKDMQECMQLNFSVFREGE
AMADGLKQLGEIRERLQNARLDDKSADFNTQRIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDFPDRDDENWLCHSVYDPNTEKMLKRDVNMAPKLREAFPPKVRSY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacccgttcacgagtttgacgcagtagttattggtgctggtggcgctggtatg
cgtgcagcattacagatttcagaatctggaaaatcatgtgcactactgtctaaagtattt
cctacccgttcacatacggtatcagcgcaaggtggtatcactgttgcgctaggtaattcc
catgaagataactgggaatggcacatgtacgacactgtaaaagggtcggactacattggt
gaccaagacgctatcgaatatatgtgtaaaaccggcccagaagccatcattgagatggaa
aacatgggtttacctttctcacgctttgagaatggtaaggtttaccagcgtcctttcggt
ggtcaatcaagaaatttcggtggcgagcaagcagctcgaaccgcagccgccgctgaccgt
actggtcacgccttgctgcatttgctttatcagcaaaacgtaaagaataaaacaaaggtc
ttttctgagtggtatgcactcgacctagttaaaaaccaagacggtgatgttgttggttgt
actgctatcgatatcgaaacaggcgaagtggtttatttcaagtctaaagcggtagtactt
gcgacaggtggagcagggcgtattttcgcttctactaccaatgcacacattaacaccggt
gacggtgttggtatggcaattcgcgctggtgttgcactacaagatatggaaatgtggcag
ttccaccctacgggtatcgccggtgctggtacgctagtaacggaaggttgtcgtggtgaa
ggtggttacctacttaataaagacggtgaacgcttcatggaacgttatgcgcctaacgcg
aaagacctcgctggtcgtgacgttgtagcacgttcaatgatgacagaaattcgcgaaggc
cgcgggtttgatggcccttggggacctcactgtaaactcaaacttgatcaccttggtaaa
gacgtacttgagtctcgtttaccaggtattcttgagctttctcgtacgtttgctcacgtt
gatccagttaaagaaccgattcctgtaatacctacatgtcactatatgatgggtggtatt
cccactactgttgacggtcaatgtctaactgtagatgctgacggtaacgataaagtggta
aatggcttattcgcttgtggtgaaattgcatgtgtatctgtacatggcgctaaccgctta
ggcggtaactcactacttgaccttgtagtattcggtcgtgcgactggactacacttaggt
aaaaccctttctgacgtatcgccattccgcgaagcatcagagtctgaccttgaagtggct
atgtctcgcttcaatcgctgggaaaactcagagaaaggcaagggcgaagatccggttcaa
atcaaaaaagatatgcaagaatgcatgcagcttaacttctcagtattccgtgaaggtgaa
gccatggcagacggtcttaagcaacttggtgaaattcgtgaacgtcttcagaatgctcgc
cttgatgataagagtgccgatttcaatacacagcgtattgaatgtcttgagcttgataac
cttatggaaaccgcgtacagcacagcagtagcagcgaacttcagaacggaaagccgtggc
gcacacagccgcttcgatttcccggaccgtgacgatgagaactggttatgccacagcgtt
tacgatccgaatactgaaaaaatgcttaaacgtgatgtcaatatggcgcctaagcttcgg
gaagctttcccgcctaaagtgcgttcatattaa

DBGET integrated database retrieval system