KEGG   Alteromonas sp. Mac1: AV939_15195Help
Entry
AV939_15195       CDS       T05687                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00010  Glycolysis / Gluconeogenesis
ale00020  Citrate cycle (TCA cycle)
ale00620  Pyruvate metabolism
ale01100  Metabolic pathways
ale01110  Biosynthesis of secondary metabolites
ale01120  Microbial metabolism in diverse environments
ale01130  Biosynthesis of antibiotics
ale01200  Carbon metabolism
Module
ale_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AV939_15195 (aceE)
   00020 Citrate cycle (TCA cycle)
    AV939_15195 (aceE)
   00620 Pyruvate metabolism
    AV939_15195 (aceE)
Enzymes [BR:ale01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     AV939_15195 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AMJ87802
LinkDB All DBs
Position
complement(3549837..3552512)
Genome map
AA seq 891 aa AA seqDB search
MTDMMHQDVDPQETKEWIDALESVLEEEGVERAHYLLEKLIDKARRSGAHLPYDATTAYI
NTIPSAQEPKMPGDLTIEARIRAAIRWNALMIVLRASKKDLELGGHIGSFASSAMLYDVG
FNHFFKAPTENAGGDFIFAQGHISPGIYARSFIEGNLSEEQLNNFRQECAGEGLSSYPHP
HLMKDYWQFPTVSMGLGPLQAIYTARFLKYLTNRGIKDCSEQRVYCYMGDGECDEPESLG
AIGLASREGLDNLTFVINCNLQRLDGPVRGNGKIIQELEGTFRGAGWEVVKVIWGSYWDE
LLARDKSGKLIQLMGETVDGEYQNCKAKGGKYTRENFFNKYPETAALVANMSDDDIWRLN
RGGHDPVKVFAAYQKAKETKGRPTVILAKTVKGFGLGASGEALNIAHNVKKMDVDSLKVF
RDRFNIPIADEKIEELPYFKFPEDSEEMKYLRERRESLGGYLPSRREQAEEQLEVPELKA
FDAILKGSGDRSVSSTMTFVRVLNALLKDKKIGKRIVPIIPDEARTFGMEGLFRQVGIYA
NEGQKYVPQDADQVAYYREDKKGQVLQEGINELGAMASWVAAGTSYSTCNATTIPFYIYY
SMFGFQRVGDLAWAAGDSQARGFLLGATAGRTTLNGEGLQHQDGHSHVQANLIPNCVTYD
PTYGYEVAVIVQDGLRRMYGNNENVFYYLTLMNENYQHPAMPEGDDVADQIIKGIYKLER
VENKKTKTNVQLMGSGTILNEVRKAAQILCDDYNVSSDVYSVTSFNELAREGQEVARWNM
LNPEADQKTAYIGQVITKDAGPAISATDYVKNYSDQVRAFIDTDYRCLGTDGFGRSDSRE
NLRTHFEVNAAYIVVASLYELAQRGEFDKKDVAEAIKRFDINVEKLNPLYA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatgatgcaccaagatgtggatcctcaagaaactaaagagtggattgacgct
cttgaatctgttttggaagaggaaggtgtagaacgcgcccattatctactcgagaaactg
attgataaggctcgtcgtagcggagcgcacttaccgtacgacgccaccacagcgtacatc
aatacaattccttcagcgcaagagccaaaaatgcctggcgacctaacgattgaagcacgt
attcgtgcagccattcgttggaatgcattgatgattgtattacgtgcttctaagaaagac
ttagagcttggtggtcacattggtagttttgcgtcatctgccatgctatacgatgttggt
tttaaccacttctttaaagcgcctacagaaaatgctggcggcgactttatttttgctcaa
ggccatatctctccaggtatttatgcccgttctttcattgagggtaacctttctgaagaa
cagctaaacaacttccgtcaagaatgtgctggtgaaggcttatcttcatacccacaccct
cacttgatgaaagattactggcagttcccaacagtatcgatgggcttaggtccacttcaa
gccatctatactgctcgtttccttaagtaccttactaatcgtggtatcaaagactgttct
gaacagcgcgtatactgctacatgggtgacggcgagtgtgatgagccagaatcattaggt
gctattggtcttgcctcacgcgaaggcctagataacttaactttcgttatcaactgtaac
ctacagcgcctagacggcccggtacgtggtaacggcaaaattatccaagaacttgaaggc
acattccgcggcgcaggctgggaagtggttaaagttatttggggcagttactgggatgag
cttcttgcccgtgataaatcaggcaaacttattcagttaatgggcgaaaccgtagacggt
gagtaccagaactgtaaggcgaagggtggtaaatacactcgcgaaaacttcttcaacaag
tacccagaaacggctgcacttgtagcgaacatgtctgatgatgacatctggcgcttgaac
cgtggtggacacgatccagttaaagtctttgctgcttatcaaaaagcgaaagagaccaaa
ggtcgtccaacggttattcttgctaaaacagttaaaggctttggtttaggtgcttctggt
gaagccttgaacattgcgcataacgtgaagaaaatggacgttgattcacttaaagtgttc
cgtgatcgtttcaacattccaatcgctgatgagaagattgaagagctaccttacttcaag
ttccctgaagacagtgaagaaatgaagtacttgcgcgagcgtcgtgagtctttaggcggt
tacttaccttctcgtagagaacaagctgaagaacaacttgaagtacctgaattaaaagct
ttcgatgcaatcttaaaaggctcaggcgatcgttcagtatcgtctactatgacctttgtt
cgcgtacttaatgcgttgttgaaagacaagaaaattggtaagcgtattgtgccaattatt
cctgatgaagcacgtacattcggtatggaaggacttttccgccaagtgggcatttatgct
aacgaaggccaaaagtacgttccacaagatgcagaccaagtggcttactatcgtgaagat
aaaaaaggccaagtattgcaggaaggtattaacgaattaggtgcaatggcatcgtgggta
gcagcaggtacatcttactcaacctgtaacgccacgactattccgttctacatttactac
tcaatgtttggtttccaacgtgttggcgacttagcgtgggcagctggcgatagccaagca
agaggcttcttgttaggtgctactgcaggtagaacaacattgaacggtgaaggtctacag
caccaagatggtcattcacatgttcaagcgaaccttatcccgaactgtgtaacttacgat
ccaacttacggatacgaagtggctgttatcgtacaagacggtttacgccgcatgtatggc
aacaacgaaaacgttttctattacctaacattgatgaacgagaactaccaacacccagct
atgcctgaaggtgatgacgtagcagatcaaatcattaaaggtatttataagcttgaacgc
gttgaaaacaagaagaccaagaccaatgtacagttaatgggctcgggtactatcttgaat
gaagtacgtaaagcggcacagattctttgtgacgattacaatgtttcttcagacgtttac
tcggttacctcgttcaacgaattggctcgcgaaggtcaagaagtggcgcgctggaacatg
ttgaacccagaagccgatcagaaaacagcttacattggtcaggtaatcacgaaagatgca
ggtcctgctatttcggcgaccgactacgtgaagaactactctgatcaggttcgtgcattt
atcgatactgattaccgctgcctaggtactgatggctttggtagaagtgatagccgtgaa
aacttgcgtactcactttgaagttaacgctgcatacattgtagtagcttcattgtacgaa
ttggcgcaacgcggtgagttcgataagaaagatgttgccgaagcgattaaacgttttgat
attaacgttgaaaaactaaacccactttacgcgtag

DBGET integrated database retrieval system