KEGG   Agrobacterium larrymoorei: CFBP5473_05075Help
Entry
CFBP5473_05075    CDS       T06268                                 

Definition
(GenBank) DUF4130 domain-containing protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
alf  Agrobacterium larrymoorei
Pathway
alf03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:alf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CFBP5473_05075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:alf03400]
    CFBP5473_05075
Enzymes [BR:alf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     CFBP5473_05075
DNA repair and recombination proteins [BR:alf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CFBP5473_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4130 UDG Toxin_6
Motif
Other DBs
NCBI-ProteinID: QCI97348
UniProt: A0A4D7DMN7
LinkDB All DBs
Position
circular:1072221..1073675
Genome map
AA seq 484 aa AA seqDB search
MYSVELEGRGDFVEWRNAARSLLMADIDPRDVDWRLESERGTLLGFEESRSIPAGDSSRA
ISVPAAFLPLAEAVICHSDPARFALLYRLLWRLQKDRSLLQIKADPNVLTARHLEKSVRR
DSHKMTAFVRFKEVEGEGPAARRCFIAWFEPDHFIVERKAPFFQRRFTDMDWLIATPKGS
ARWDGKTLETSREAAEKPDLTDETDELWRTYYANIFNPARLKIKAMTAEMPKKYWKNLPE
AGLIPELILGAEARVLEMGAKAATEPQLFHHRLQAAASAKPEELLPDADTLAGLKREAQS
CELCPLHCKATQTVFGEGLSDAEIMIVGEQPGDHEDLAGRPFVGPAGRVFDQVLAETEID
RKSLYVTNAVKHFKYEARGKKRIHQRPDAGEVERCRWWLTREIELVQPKLIVAMGATAVY
SLTGMKEKISDLRGRPMPMSEGRMLFVTVHPSYLLRIPDESQKSYEFARFRDDMKLMKEI
AANL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcgtggaactggagggccggggggattttgtcgagtggcgcaacgccgcgcgc
tccctgcttatggccgatatcgatccgcgcgacgtggactggcgcctggagagtgaaaga
ggcacccttctgggatttgaggagagccgctctatcccagcgggcgatagcagccgggct
atcagcgttccagccgccttcttaccgcttgcggaagcggtgatttgccacagcgatcca
gcgcgctttgcgttactgtatcggttgttgtggcgattgcagaaggacaggtcgcttttg
caaatcaaggccgacccgaacgtcctgactgcgcgccatttggaaaaatcggtgcgacgc
gacagccataaaatgacggccttcgttcgcttcaaggaagtggaaggtgaagggccagcg
gcgcggcgctgttttatcgcctggttcgagccggatcatttcatcgtggagcgaaaagcg
ccgttttttcagcgacggttcacagatatggattggctgattgccacccccaagggctct
gcgcgctgggatggaaagacgctggaaacctcgcgcgaagcagccgaaaaacctgatctt
accgacgagacggatgagttgtggcgcacctattacgctaatatcttcaacccggcacgg
ctgaaaataaaggcgatgacggcggagatgccgaagaaatactggaagaatttgccggag
gccgggcttatccctgaacttattctgggtgcggaagcacgcgtgctggaaatgggcgca
aaggcagcgacagagccgcagctttttcatcatcgtcttcaggcggcggcatccgccaag
ccggaagagttgttaccagatgcggatacgctggcaggtctcaagcgcgaagcgcaaagt
tgtgagctttgtccgttgcattgcaaggcgactcagacggtattcggcgaaggtttgagc
gatgctgagatcatgatcgttggtgagcagccgggggatcatgaggatctggctgggcgt
ccgttcgtcggtcctgcgggcagggtgttcgatcaagtgctggcggaaacggagatcgat
agaaaatcgctttatgtgaccaatgcggtcaagcacttcaaatatgaagcacgcggcaag
aagcgcatacaccagcgcccggatgctggtgaggtggagcgttgccggtggtggctgacg
cgggaaatagagctcgttcagccaaagctgatcgtggccatgggggcaacggcggtctat
tcactgaccggaatgaaggagaagatttccgatctccgcgggcggcccatgcccatgtca
gagggccgcatgctcttcgtcaccgttcatccttcctatctactgcgcattcctgatgag
tctcaaaaatcctatgagttcgcacgcttcagggatgacatgaagctgatgaaggagatc
gccgcaaacctgtag

DBGET integrated database retrieval system