KEGG   Agrobacterium larrymoorei: CFBP5473_20890Help
Entry
CFBP5473_20890    CDS       T06268                                 

Definition
(GenBank) carboxymuconolactone decarboxylase family protein
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
alf  Agrobacterium larrymoorei
Pathway
alf00362  Benzoate degradation
alf01100  Metabolic pathways
alf01120  Microbial metabolism in diverse environments
alf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFBP5473_20890
Enzymes [BR:alf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     CFBP5473_20890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: QCJ00380
UniProt: A0A4D7DZL0
LinkDB All DBs
Position
linear:1449868..1450278
Genome map
AA seq 136 aa AA seqDB search
MTQSLPHQEESRLERGQRALAEIDGEAGAKVIAALADIAPDFATYLFEFPFGDIYSRPGL
DLKSREIATIAALTALGNAAPQLKVHIEAGLNVGLSREEITETIMQMAVYAGFPAALNGL
FAAEEVFAERTAKSVA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctctaccccatcaggaagaaagcaggctggaacgcggacaacgcgcactc
gctgaaatagacggagaggccggggcaaaagtcattgccgcattggcggatatcgctccc
gacttcgccacctacctgttcgaatttcccttcggcgatatttacagccgaccgggactg
gacctgaaatcacgcgaaatcgcgaccatcgctgcgctgaccgccctcggcaacgctgca
ccgcaattgaaggtgcacatcgaggccggtctcaacgtcggactttcccgtgaagaaatc
acggaaaccatcatgcagatggcggtctatgcgggcttccctgcggcgttgaacggcctc
ttcgccgcagaggaagtctttgctgaacgcaccgccaaatcggtcgcgtaa

DBGET integrated database retrieval system