KEGG   Altererythrobacter sp. BO-6: G6N82_06555Help
Entry
G6N82_06555       CDS       T06465                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
alh  Altererythrobacter sp. BO-6
Brite
KEGG Orthology (KO) [BR:alh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G6N82_06555 (ahpF)
Enzymes [BR:alh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G6N82_06555 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored K_oxygenase FMO-like AlaDh_PNT_C Spermine_synth
Motif
Other DBs
NCBI-ProteinID: QIG53859
LinkDB All DBs
Position
1339291..1340880
Genome map
AA seq 529 aa AA seqDB search
MLDQAMKDQLKQYLANLREPIELVASLGDDAKSAQTRELLEEISALHDLVSASFDGDNAR
KPSFEIRRASDTSRAVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQVRALDSDYE
FEMFFSLSCHNCPDVVQALTLMALENPRISATLIEGGTFQAEVEARDILAVPATFLNGAP
FYNGKMELAEILAKLDDGAGDRAAAQFAAKAPFEVLVLGSGPAGVGSAIYTARKGFRTGL
AGERFGGQLQDTLGIENLPGTPYTEGPKLAGEMQRHVGEYDIDVINLATAARLIAADHAG
GMHTVEFANGGSLKTRALVLATGARWRELGVPGEAEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLIEFDSKLRADEVLQAKLQSLANVTIIKSAQTTEITGA
NGRVNGLVYIDRTSGEERQIELEGVFVQIGLVPNTEWLKDSGLELSRYGEIVIDSHGATN
LPGVFAAGDCTTVPYKQIVVAMGEGSKAGLSAFDYLIRNVADEDVAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccaagccatgaaggaccagcttaagcagtatctcgccaatttgcgcgagccg
atcgagctcgtcgccagcctgggtgacgatgccaagtccgcgcagacacgcgagctgctg
gaagagatttccgcgctgcatgacctcgtctcggccagctttgacggtgacaatgcccgc
aagcccagcttcgaaattcgccgcgccagcgacacatcgcgcgccgtgcgcttcgccggg
ctgccgatgggccacgaattcacctcgctggtgctggcgctgctgtgggctggcggccac
ccgcccaaggtcgatgccgatctgatcgaacaggtccgcgcgctggacagcgactacgaa
ttcgaaatgttcttctcgctcagctgccacaattgccccgatgtggtgcaggcgctgacg
ctgatggcgctggagaatccgcgcatttctgccacgctgatcgaaggcggcacgttccag
gctgaagtcgaggcgcgcgatatcctggcagtgccagcgaccttcctcaacggcgccccc
ttctacaacggcaagatggaactggccgagattctggcgaagctcgacgatggcgccggt
gatcgcgctgccgcgcaatttgccgcgaaggcgccgttcgaagtgctggtgctgggcagc
ggcccggcaggtgtcggcagcgcgatctacaccgcgcgcaagggcttccggaccggactt
gccggggagcgcttcggcggccaactgcaggacactctcggcatcgagaaccttcccggc
accccctataccgaagggcccaagctggcgggcgagatgcagcgccatgtcggcgaatac
gatatcgatgtaatcaaccttgccaccgcagcccggctcattgccgccgaccatgcaggc
gggatgcacacggtcgaattcgccaatggcggttcgctgaagacccgcgcgctggtcctg
gcgaccggcgcccgctggcgcgaactgggcgttccgggagaggcggagtatcgcaacaag
ggcgtagcctattgcccccactgcgacggtccactgttcaagggcaagcgcgtggccgtg
atcggcggcggcaattccggtgtcgaggcggcgatcgacctcgccaatatcgtcggccat
gtcacgctgatcgaattcgacagcaagctgcgcgccgatgaagtgctgcaagccaagctg
cagagcctcgccaatgtcaccatcatcaaatccgcccagacgaccgagatcaccggcgcc
aatggccgggtgaacgggctggtttacatcgaccgcaccagcggcgaggaacgccagatc
gagctggaaggcgtattcgtccagatcggcctggtgcccaataccgagtggctgaaggac
agtgggctcgaactcagccgctatggcgaaatcgtgatcgattcccacggcgcgaccaat
ctgccgggcgtcttcgcggcgggcgattgcaccactgttccttacaagcagatcgtggtg
gcaatgggtgaaggatcgaaagcgggcctctccgccttcgattacctgatccgcaatgtc
gccgacgaggatgtggcgcaagccgcctga

DBGET integrated database retrieval system