KEGG   Azospirillum lipoferum: AZOLI_0439Help
Entry
AZOLI_0439        CDS       T01658                                 

Gene name
tufB1
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ali03012]
    AZOLI_0439 (tufB1)
   03029 Mitochondrial biogenesis [BR:ali03029]
    AZOLI_0439 (tufB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ali04147]
    AZOLI_0439 (tufB1)
Translation factors [BR:ali03012]
 Eukaryotic Type
  Elongation factors
   AZOLI_0439 (tufB1)
 Prokaryotic Type
   AZOLI_0439 (tufB1)
Mitochondrial biogenesis [BR:ali03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AZOLI_0439 (tufB1)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AZOLI_0439 (tufB1)
  Exosomal proteins of breast cancer cells
   AZOLI_0439 (tufB1)
  Exosomal proteins of colorectal cancer cells
   AZOLI_0439 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBS85817
UniProt: G7Z357
LinkDB All DBs
Position
416709..417899
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNVGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLELVELEVRELLSSYQFPGDDIPITKGSALCALE
DRQPEIGRDAVLALMKTVDEYIPQPERPKDRPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGDEVEIVGLKATVKTTVTGVEMFRKLLDSGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGMVSLPEGVEMVMPGDNVA
MEVALIAPIAMDEGLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcaaagtttgagcggaacaagccgcactgcaacgttggcacgatcggccac
gtcgaccacggcaagacgtcgctgacggcggcgatcacgaaggtgctggcggagtccggc
ggcgccaccttcaccgcttacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgaccgcccacgtcgagtacgagacgaccaaccgccactacgcgcacgtc
gactgcccgggccacgccgactatgtgaagaacatgatcaccggtgccgcccagatggac
ggcgcgatcctggtcgtgtcggccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcgcgccaggtcggcgttccggcgctggtggtgttcatgaacaaggtcgacatg
gtcgacgatccggagctgctggagctggtcgagcttgaagttcgcgagctgctgtcctcc
taccagttcccgggcgacgacattccgatcaccaagggctcggcgctgtgcgcgctggaa
gaccgtcagccggagatcggccgcgacgccgttctggcgctgatgaagacggtggacgag
tacatcccgcagccggagcgtccgaaggaccgtccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgcgtcgagcgcggcatcgtgaag
gtcggtgacgaagtcgagatcgtcggcctgaaggcgacggtgaagacgacggtgaccggc
gtcgagatgttccgcaagctgctcgattcgggtgaggccggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgcgaggacgtcgagcgcggtcaggttctggccaagccgggttcg
atcaccccgcacaccaagttcaaggccgaagcctacatcctgacgaaggaagagggcggc
cgtcacaccccgttcttcaccaactaccgtccgcagttctacttccgtacgacggacgtg
acgggcatggtctcgctgccggaaggcgtggagatggtgatgccgggcgacaacgtcgcg
atggaagtggctctgatcgccccgatcgccatggacgaaggcctgcgcttcgccatccgc
gagggtggccgtaccgtcggcgccggcgtcgttgccaagatcgtcgagtga

DBGET integrated database retrieval system