KEGG   Azospirillum lipoferum: AZOLI_0736Help
Entry
AZOLI_0736        CDS       T01658                                 

Gene name
acoA1
Definition
(GenBank) Acetoin:2,6-dichlorophenolindophenol oxidoreductase, alpha subunit
  KO
K21416  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZOLI_0736 (acoA1)
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AZOLI_0736 (acoA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: CBS86095
UniProt: G7Z9I3
LinkDB All DBs
Position
complement(693615..694598)
Genome map
AA seq 327 aa AA seqDB search
MAQNPFPLGKDELLKAYRTMRTIREFEERLHVDFAKGDIPGFVHLYAGEEACATGIMMHL
NDNDRIASTHRGHGHCIAKGVDVHAMMAEIYGRSTGACRGKGGSMHIADLSKGMMGANGI
LGAGAPLICGAALAAKVRGDRGVGITFVGDGASNQGTFLESLNLAAVWNLPVVFVVENNG
YAESTAMEWAVSCDSYVDRATGFGMPGVTVDGTDFFAVYEAAGEIIRRARDGGGPALLEC
NMVRFYGHFEGDAQTYRAKGELEAIRASRDCLTILSERVIEAGVIGRDELQAIDREVNAL
IEDATRAAKAAPLPVPEDLLRDVYVAY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaatcccttccccctcggcaaggacgagctgctgaaggcctaccgcaccatg
cggacgatccgcgagttcgaggagcggctgcacgtcgatttcgccaagggcgacatcccc
ggcttcgtccacctctatgccggtgaggaggcctgcgccaccggcatcatgatgcacctg
aacgacaacgaccgcatcgcctccacccaccgcggccacggccactgcatcgccaagggc
gtcgacgtccacgcgatgatggcggagatctacggccgcagcaccggcgcctgccgcggc
aagggcgggtcgatgcacatcgccgacctgtccaagggcatgatgggcgccaacggcatc
ctcggcgccggcgcgccgctgatctgcggcgccgcgctggcggccaaggtgcgcggcgac
cgcggcgtcggcatcaccttcgtcggcgacggcgcgtcgaaccagggcaccttcctggag
agcctgaacctcgccgcggtgtggaacctgccggtggtcttcgtggtggagaacaacggc
tatgccgaatccaccgcgatggaatgggcagtgtcctgcgacagctatgtcgaccgcgcc
accggcttcggcatgccgggcgtcacggtggacggcaccgacttcttcgcggtgtacgag
gcggccggcgagatcatccgccgcgcccgcgacggcggcggcccggccctgctggaatgc
aacatggtccgcttctacggccatttcgaaggcgacgcccagacctatcgcgccaagggc
gagttggaggcgatccgcgcctcccgcgactgcctgaccatcctgtcggaacgggtgatc
gaggccggggtgatcggccgcgacgagttgcaggccatcgaccgcgaagtgaacgcgctg
atcgaggacgctacgcgcgccgccaaggccgccccgctgccggtgccggaagacctgctc
cgcgacgtttacgtcgcctactga

DBGET integrated database retrieval system