KEGG   Azospirillum lipoferum: AZOLI_1390Help
Entry
AZOLI_1390        CDS       T01658                                 

Gene name
sodB1
Definition
(GenBank) superoxide dismutase, iron/manganese cofactor
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ali  Azospirillum lipoferum
Brite
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AZOLI_1390 (sodB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBS86696
UniProt: G7Z511
LinkDB All DBs
Position
1319806..1320399
Genome map
AA seq 197 aa AA seqDB search
MAFELPPLPYAYDALAPYISSETLHLHHDKHHQTYVTNLNNLTKDTPLADASLEEVIKAS
VGDASKVGIFNNAAQVWNHTFFWQCLKKDGGKMPAALEQRIVADFGSVEKFKEELTQAAL
TQFGSGWAWLYLDGDKLKIGKTGNADTPLAHGHKPLFTIDVWEHAYYVDFQNRRADFVKA
VIDNLANWDFAAEQMAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaacttccgccgcttccgtatgcgtacgatgccctggctccgtacatctcg
tcggagacgctgcacctgcaccacgacaagcaccaccagacctatgtcaccaacctgaac
aacctgaccaaggacaccccgctggccgacgccagcctggaggaggtcatcaaggcttcg
gtcggcgacgcttcgaaggtcggcatcttcaacaacgccgcccaggtgtggaaccacacc
ttcttctggcagtgcctgaagaaggacggcggcaagatgccggcggccctggagcagcgc
atcgtcgccgacttcggcagcgtcgagaagttcaaggaagagctgacccaggccgccctg
acccagttcggttccggctgggcctggctctacctggacggcgacaagctgaagatcggc
aagaccggcaacgccgacaccccgctggcgcacggccacaagccgctgttcaccatcgac
gtgtgggagcatgcctattacgtcgacttccagaaccgccgcgccgacttcgtgaaggcc
gtcatcgacaacctcgccaactgggacttcgccgccgagcagatggctgcgtga

DBGET integrated database retrieval system