KEGG   Azospirillum lipoferum: AZOLI_1942Help
Entry
AZOLI_1942        CDS       T01658                                 

Definition
(GenBank) putative trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ali  Azospirillum lipoferum
Pathway
ali00500  Starch and sucrose metabolism
ali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOLI_1942
Enzymes [BR:ali01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AZOLI_1942
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AZOLI_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CBS87190
UniProt: G7Z1Q7
LinkDB All DBs
Position
complement(1816168..1817853)
Genome map
AA seq 561 aa AA seqDB search
MIGDLWYKNAVIYNLALSTFMDASGDGIGDFQGLLRRLDYLHGLGVTCIWLGPFQTSPMK
DDGYDVADYYTVDPRYGTLGDFVEFTHACEQRGIRVIIDLVINHTSDRHPWFKAARSDPG
SKYRNWYVWSDRKPANADTGMVFPGVQESTWTYDREAKAWYFHRFYKFQPDLNTAHPEVH
AELLKIMGFWIQLGVAGFRMDAVPFIIAEKGAEVTEPKEQFGMLRSFREFVQWRRGDAVL
LAEANILPEDDLHYFGDDGDRCHMMFNFQVNQTLFYALATADTAPLVTALKVTKPRPATA
QWGCFLRNHDELDLGRLTEEQRQAVFAAFGPEKCMQLYDRGIRRRLAPMLHDDRRRIELA
YSLMFTLPGTPVIRYGDEIGMGDDLSLPERNCARTPMQWSDEPHGGFTKSDGPEIPVIAG
GVFGYERINAAVQRRDPESLLNWTERIIRMRKECPEIGWGDFQILKTGRPEVLALRYDWR
NNGVVVLHNLSDKPCEILLDVEGHGEACRLVNLLSEDHSEPDSEGRHDLVLEAYGYRWFR
VGGLDYLLRRTEADKKPGEGG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgatcggggacctctggtacaagaatgcggtgatctacaatctggcgctgtcgactttc
atggacgccagcggcgacggcatcggcgatttccaggggctgctgcgccggctggattac
ctgcacgggctgggcgtgacctgcatttggctggggccgttccagacatcgccgatgaag
gacgacggctatgacgtcgccgactactacactgtcgatccgcgatacggcactctgggc
gacttcgtggaattcacccatgcctgcgagcagcgcggcatccgggtcatcatcgatctg
gtgatcaaccacacctccgaccggcatccctggttcaaggcggcccgcagcgatccgggc
agcaagtatcgcaactggtacgtctggtcagacaggaagccggcgaatgccgacaccggc
atggtctttcccggcgtgcaggaatcgacctggacctatgaccgcgaggcgaaggcctgg
tacttccaccgcttctacaaattccagcccgacctgaacacagcccacccggaggtgcat
gccgagctgctgaagatcatgggcttctggatccagctgggcgtcgccggattccgcatg
gacgccgttcccttcatcatcgccgagaagggggcggaggtgaccgagccgaaagagcag
ttcggcatgctgcgcagtttccgcgaattcgtgcagtggcgccgcggcgatgccgttctg
ctggcggaggccaacatcctgccggaggacgacctgcattacttcggcgacgacggcgac
cgctgccacatgatgttcaatttccaggtcaaccagactctgttctatgcgctggccacc
gccgacaccgcgccgctggtgacggcgctgaaggtgacgaaaccgcgcccggccaccgcc
caatggggctgtttcctgcgcaaccacgacgagttggatctcggccgcctgacggaggag
cagcgccaagccgtctttgccgccttcgggccggagaaatgcatgcagctctacgaccgc
ggcatccggcggaggctggcgccgatgctgcacgacgaccggcggcggatcgagctggcc
tacagcctgatgttcaccctgccggggacgccggtcatccgctatggcgacgagatcggc
atgggcgacgacctgtcgctgccggagcgcaactgcgcccgcacgccgatgcaatggtcg
gacgaaccgcatggcggcttcaccaagtcggacgggccggaaatcccggtgatcgccggc
ggggtcttcggctatgagcggatcaacgccgcggtgcagcgccgcgaccccgaatcgctg
ctgaactggaccgagcgcatcatccgcatgcgcaaggaatgcccggagatcggctggggc
gacttccaaatcctgaagaccggccggccggaggtgctggctctgcgctatgactggcgc
aacaacggggtggtcgtcctgcacaacctgtcggacaagccctgcgagatcctgctggac
gtcgagggccacggcgaggcctgccggctggtcaacctgctgtcggaggaccacagcgag
cccgacagcgaggggcgccatgatctggtgctggaagcctacggctatcgctggttccgc
gtcggcgggctggattacctgctgcgccggacggaggcggacaagaaacccggcgagggg
ggttag

DBGET integrated database retrieval system