KEGG   Azospirillum lipoferum: AZOLI_2134Help
Entry
AZOLI_2134        CDS       T01658                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ali  Azospirillum lipoferum
Pathway
ali00473  D-Alanine metabolism
ali00550  Peptidoglycan biosynthesis
ali01100  Metabolic pathways
ali01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AZOLI_2134 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZOLI_2134 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AZOLI_2134 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ali01011]
    AZOLI_2134 (ddlB)
Enzymes [BR:ali01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AZOLI_2134 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ali01011]
 Precursor biosynthesis
  Amino acid ligase
   AZOLI_2134 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 NAD_binding_8 ATP-grasp_4 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CBS87364
UniProt: G7Z1Z4
LinkDB All DBs
Position
2024159..2025118
Genome map
AA seq 319 aa AA seqDB search
MTEVLLHAHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAIDVQRDLGGLMHA
LTNPRPDVVFNALHGRGGEDGTIQGVLEFLGLPYTHSGVQAAAIAMDKAMTKRVLDTVGI
RSPKGMVLSRGEIAGGAHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDDGFFGGTFGE
RVLVEEFIPGRELTVGVMGDRALAVTEIVFQAQVYDYTAKYSAGHAVHTIPAAIPEAVAE
EAKRMAVLAHHTLGCRGVSRSDFRWDDGRPGTDGLYFLEINNQPGMTPLSLVPEQAAHVG
ISYGALVGWLVENAACQLA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtcctgctccacgcccacaagaagcatgtcgccgtcctgatgggcggctgg
tcggccgagcgcgaggtgtcgctggtcagcggtgccggcgtcgccaaggcgctggaagag
gaaggctaccgcgtcaccgccatcgacgtgcagcgcgacctgggtgggctgatgcacgcc
ctgaccaacccgcgccccgacgtggtgttcaacgccctgcacggccgcggcggcgaggac
ggaacgatccagggcgtgctggagttcctgggcctgccctacacccattcgggcgtccag
gcggcggccatcgccatggacaaggcgatgaccaagcgcgtgctggacaccgtcggcatc
cgctcccccaaaggaatggtgctgtcccgtggggagatcgccggcggcgcccaccccatg
ccggcgccctatatcgtcaagcctgtggacgagggctcgaccgttggcgtaaccctggtc
cgcgaggggcagaacagcccggtcggcgacgatggcttcttcggggggaccttcggagaa
cgcgtgctggtcgaggagttcatccccggtcgcgaactgaccgtgggcgtcatgggtgac
cgcgctttggcggtgaccgaaatcgtcttccaggctcaggtctacgactacaccgcgaaa
tacagcgccggccatgccgtccacaccatccccgccgcgatccccgaggccgtggcggag
gaggcgaaacggatggcggtgctggcgcaccacaccctgggctgccggggtgtctcgcgc
agcgacttccgctgggatgacggccggccgggaacggacgggctgtacttcctggagatc
aacaaccagccgggcatgacgcccctgtcgctggtgcccgaacaggcggcgcatgtggga
atttcctacggcgcgctggtcggctggctggtggagaatgccgcatgtcagctcgcctga

DBGET integrated database retrieval system