KEGG   Azospirillum lipoferum: AZOLI_p10723Help
Entry
AZOLI_p10723      CDS       T01658                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit)
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ali  Azospirillum lipoferum
Pathway
ali00630  Glyoxylate and dicarboxylate metabolism
ali00710  Carbon fixation in photosynthetic organisms
ali01100  Metabolic pathways
ali01120  Microbial metabolism in diverse environments
ali01200  Carbon metabolism
Module
ali_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ali_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AZOLI_p10723 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOLI_p10723 (cbbS)
Enzymes [BR:ali01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AZOLI_p10723 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CBS88949
UniProt: G7ZBW2
LinkDB All DBs
Position
AZO_p1:complement(733665..734105)
Genome map
AA seq 146 aa AA seqDB search
MRLTQGQFSFLPDLTDEEITKQVQYALDQGWAVAVEFTDDPHPRNSYWTMWGNPMFDLRD
AKGVMMEIDACRSAHPDQYVKVLAFDSSYGFETVRMSYLINRPAVEPGFELLRSEGPGRR
IGYTVRSYATGRPPGDRYGGEARHGA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgacacagggtcagttctccttcctgccggatttgacggatgaggagatcacc
aaacaggtgcaatacgccctcgaccagggctgggcggtggcggtggagttcaccgacgat
ccgcacccgcgcaacagctattggacgatgtggggcaaccccatgttcgacctgcgcgac
gccaagggcgtgatgatggaaattgacgcctgccgcagcgcccatcccgaccagtacgtc
aaggtcctcgccttcgacagctcctatgggttcgagacggtgcgcatgtcctacctgatc
aaccgcccggccgtggaacccggtttcgagctgttgcggtcggaggggccggggcggcgc
atcggctacacggtgcgcagctatgccaccggccgtccgccgggagaccgctatggcggg
gaggcgcgtcatggggcgtga

DBGET integrated database retrieval system