KEGG   Azospirillum lipoferum: AZOLI_p10724Help
Entry
AZOLI_p10724      CDS       T01658                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ali  Azospirillum lipoferum
Pathway
ali00630  Glyoxylate and dicarboxylate metabolism
ali00710  Carbon fixation in photosynthetic organisms
ali01100  Metabolic pathways
ali01120  Microbial metabolism in diverse environments
ali01200  Carbon metabolism
Module
ali_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ali_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AZOLI_p10724 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOLI_p10724 (cbbL)
Enzymes [BR:ali01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AZOLI_p10724 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CBS88950
UniProt: G7ZAR7
LinkDB All DBs
Position
AZO_p1:complement(734121..735617)
Genome map
AA seq 498 aa AA seqDB search
MNYVSTTLPTDQKAADGVVSDPKARYRPGVLKYRQMGYWEPDYQPKDTDVLAVFRITPQD
GVDPEEAAAAVAGESSTATWTVVWTDRLTDCERYRAKAFRVDPVPGAPGQYFAYIAYELD
LFEEGSIANLTASIIGNVFGFKPLKGLRLEDMRIPVAYLKTFQGPATGIVVERERLNNFG
RPLLGATMKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEGVN
RAIAETGEIKGTYLNVTAATMEDMYERAEFAKELGSVIVMIDLVIGYTAIQSMAKWARRN
DMILHLHRAGHSTYTRQKSHGVSFRVIAKWMRMAGVDHIHAGTVVGKLEGDPNVIRGIYD
TCRETHVPQNLQHGIFFDQPWAGLKRVMPVASGGIHAGQMHQLLTYLGEDVILQFGGGTI
GHPDGIQAGATANRVALEVMVKARNEGRDIWNEGPEILRDAARWCAPLRAALDTWKDVTF
DYASTDSVDYVPTPTAAM
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgtatcgacgactcttccaacggatcagaaggccgccgacggggtggtcagc
gacccgaaggcccgctaccggccgggcgtgttgaaataccgccagatgggctattgggag
ccggactatcagccgaaggacaccgacgttctggccgtcttccgcatcacgccgcaggac
ggcgtcgatccggaggaagcggcggcggcggtcgccggcgaaagctccaccgccacctgg
accgtggtgtggaccgaccgcctgaccgattgcgagcgctatcgcgccaaggccttccgc
gtcgatccggtgcccggcgcgccggggcagtatttcgcctacatcgcctatgaactcgac
ctgttcgaggaagggtcgatcgccaacctcaccgcctcgatcatcggcaacgtcttcggc
ttcaagccgctgaagggcctgcggctggaggacatgcggatcccggtcgcctatctgaag
accttccaggggccggccaccggcatcgtggtggagcgcgagcggctgaacaatttcggc
cggccgctgctgggcgccaccatgaagccgaagttgggcctgtccggccgcaattatggc
cgcgtggtgtacgaggcgctgaagggcgggctcgacttcaccaaggacgacgagaacatc
aactcgcagcccttcatgcattggcgcgaccgcttcctctactgcatggagggggtcaac
cgcgccatcgccgagaccggggagatcaagggcacctatctgaacgtcaccgccgccacc
atggaggacatgtacgagcgcgccgagttcgccaaggaactgggcagcgtcatcgtcatg
atcgatctggtgatcggctacaccgccatccagtcgatggcgaaatgggcgcggcgcaac
gacatgatcctgcacctgcaccgcgccggccattccacctacacccggcagaagagccac
ggcgtgtccttccgcgtcatcgccaagtggatgcgcatggccggcgtcgaccacatccat
gccggcaccgtcgtcggcaagctggagggcgaccccaacgtgatccgcggcatctacgac
acctgccgcgagacccatgtcccgcagaatttgcagcacggcatcttcttcgaccagccc
tgggccggtctgaagcgggtgatgccggtggcgtccggcggcatccatgccgggcagatg
caccagctgctgacgtatctgggcgaggacgtgatcctgcagttcggcggcggcaccatc
ggccatcccgacggcatccaggccggcgccaccgccaaccgcgtcgcgctggaagtgatg
gtcaaggcccgcaacgagggccgcgacatctggaacgaggggccggagatcctgcgtgac
gccgcccgttggtgcgccccgctgcgcgccgcgctcgacacctggaaggacgtgaccttc
gactatgcctccaccgacagcgtcgattacgtccccacccccacagcggcgatgtga

DBGET integrated database retrieval system