KEGG   Azospirillum lipoferum: AZOLI_p30203Help
Entry
AZOLI_p30203      CDS       T01658                                 

Definition
(GenBank) putative Serine/threonine kinase
Organism
ali  Azospirillum lipoferum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PP2C_2 PP2C SpoIIE APH Kdo Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: CBS90049
UniProt: G7ZED0
LinkDB All DBs
Position
AZO_p3:207801..209516
Genome map
AA seq 571 aa AA seqDB search
MRISIGQWSDKGRKDANQDFHGALIPVAPLLGMKGIALALADGISSSRVSHVASESAVKS
FLTDYYCTPESWSVKTAAQRVLAATNSWLHAQNRRSEYRYDQDRGYACTLSALVLKSATA
HLFHVGDSRIYRVAGRSLEQLTTDHRVVVSSEVSYLGRAMGVAPHLEIDYREVAVEPGDV
FLLATDGVYEHVDADFLISTIAANSDDLDRAARLAVEEALRRGSPDNLTIQILRIDAVPA
PDAGDLFQRLSDLPLPPLLEPRAEFEGYRILRELHASSRSHVYLAQDGDGGPAVVLKVPA
IDRRDDRAHLRRFLMEEWIARRVNSPHVLKPPPQSRPRRHLYVVTEYIEGQTLTQWMRDH
PSPDLPTVRAIVEQIGKGLQAFHRLEMLHQDLRPDNVMIDRTGTAKIVDFGSVLVPGILE
TMPDADRSEILGTVQYTAPEYFLGEGGTPASDLYALGVIAYQMLTGRLPYGGDAATATTR
ARQRKLVYRTALNDERDIPVWLDGVLRKAAHPDPAKRYQELSEFLYDLRHPRKHAAGARR
RPLIERNPLAFWQGLSALLALAVLVLLAGRI
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
ttgcggatctccatcggccaatggtccgacaaggggcggaaggacgccaaccaggacttt
cacggcgccctgatcccggtggcgccgcttctggggatgaagggcatcgccctggcgctg
gccgacggcatcagcagcagccgggtcagccacgtcgccagcgaatccgcggtgaagagc
ttcctgaccgactattactgcacgccggaaagctggtcggtgaagacggcggcgcagcgc
gtgctggccgcgaccaattcctggctgcacgcccagaaccggcgcagcgaataccgctac
gaccaggaccgcggctatgcctgcacgctgagcgcgctggtgctgaaatcggccacggcg
cacctgttccatgtcggcgattcccgcatctaccgcgtcgccggccggtcgctggagcag
ctgaccaccgatcaccgggtggtcgtctcgtcggaggtcagctatctcggccgggcaatg
ggcgtggcgccgcatctggagatcgactaccgcgaggtggcggtggagccgggcgacgtc
ttcctgctggcgaccgacggcgtctatgagcatgtcgatgccgattttttaatcagcacg
attgccgcaaactcggacgatctggaccgggcggcgcgactcgcggtggaggaggcgctg
cgccgcggcagtccggacaatctgacgatccagatcctgcgcatcgacgccgtgcccgct
cccgatgccggcgacctgttccaacgcctgtccgaccttccgctgccgcccctgctggag
ccgcgggcggagttcgagggctaccggattctgcgggaactgcatgccagcagccgcagc
catgtctatctcgcccaggatggcgacggcgggccggcggtggtgctgaaggttccggcc
atcgaccggcgcgacgaccgcgcccatctgcgccgcttcctgatggaggaatggatcgcc
cgtcgggtgaacagcccccatgtgctgaagccgccgccgcagagccgtccgcgccgccac
ctctatgtggtgacggaatatatcgaggggcaaacactgacccagtggatgcgcgaccat
cccagccccgacctgcccacggtgcgcgccatcgtcgagcagatcggcaaggggcttcag
gccttccaccggctggaaatgctgcaccaggacctgcggcccgacaacgtgatgatcgac
cgcaccggcaccgcgaagatcgtcgatttcggctcggttctggtgcccggcatcctggag
accatgccggacgccgaccgcagcgaaatcctgggcaccgtgcagtacaccgcgccggag
tatttcctgggcgaaggcgggacgccggcgtcggatctctatgcgctgggggtcatcgcc
tatcagatgctgaccggcaggctgccctatggcggcgatgcggcgacggccaccacgcgg
gcgcgccagcgcaagctggtctaccgcaccgccctcaacgacgagcgggacattcccgtc
tggctggacggggtgctgcgcaaggcggcccatccggacccggccaagcgctatcaggaa
ttgtcggagttcctgtacgacctgcgccacccgcgcaagcatgcggcaggggcgcggcgc
cggccgctgatcgagcgcaacccgctggccttctggcaggggctgtcggcgctgctggcg
cttgcggtgctggtcctgctggccggccggatctga

DBGET integrated database retrieval system