KEGG   Azospirillum lipoferum: AZOLI_p30376Help
Entry
AZOLI_p30376      CDS       T01658                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ali  Azospirillum lipoferum
Pathway
ali00250  Alanine, aspartate and glutamate metabolism
ali00280  Valine, leucine and isoleucine degradation
ali00410  beta-Alanine metabolism
ali00640  Propanoate metabolism
ali00650  Butanoate metabolism
ali01100  Metabolic pathways
ali01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AZOLI_p30376 (gabT)
   00650 Butanoate metabolism
    AZOLI_p30376 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZOLI_p30376 (gabT)
   00280 Valine, leucine and isoleucine degradation
    AZOLI_p30376 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZOLI_p30376 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ali01007]
    AZOLI_p30376 (gabT)
Enzymes [BR:ali01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AZOLI_p30376 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AZOLI_p30376 (gabT)
Amino acid related enzymes [BR:ali01007]
 Aminotransferase (transaminase)
  Class III
   AZOLI_p30376 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBS90203
UniProt: G7ZEK8
LinkDB All DBs
Position
AZO_p3:complement(402358..403647)
Genome map
AA seq 429 aa AA seqDB search
MTTNQSFVARREAAVSRGISAGMPFYIDRAENAEMWDIEGKRFIDFAGGIAVLNTGHRHP
KVMEAVKAQMERFTHTCAMVTPYDSFVELAEKLNALVPGPTPKKTAFFTTGAEAVENAVK
VARAATGRPGVVAFSGGFHGRTLLTMGLTGKVVPYKVGFGPFPAEIFHVPFPNAYRGISE
AESLKALDTLFKSDVDPARVAAIIIEPVQGEGGFNIASPSFLQAIRAVCDKHGIVMIVDE
IQTGFARTGKMFAVEHAGIEPDLVTMAKSLAGGFPLSALTGKAALMDAPIPGGLGGTYAG
SPLATTAALAVINVIEEEKLVERAEKLGERIAGRFRTMAQRNSLSVIGDVRNLGAMVAME
LVTDRETKEPAADLTKALVAKAAEKGLILLSCGTYANVIRVLVPLTASDALVDEGLDIIE
CSLEELVSA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaatcagtccttcgtcgcccgtcgtgaggccgccgtctcccgtggcatttcc
gccggcatgcccttctacatcgaccgggctgaaaatgccgagatgtgggacatcgagggc
aagcgcttcatcgacttcgccggcggcatcgccgtgctgaacaccggccaccgccacccg
aaggtgatggaggcggtgaaggcgcagatggagcgcttcacccacacctgcgcgatggtc
acgccctatgacagcttcgtcgagctggcggagaagctgaacgcgctggtccccggcccg
acgccgaagaagaccgccttcttcaccaccggtgccgaggcggtggagaacgccgtcaag
gtcgcccgcgccgccaccggccgtccgggcgtggtcgccttctccggcggcttccacggc
cgcacgctgctgaccatgggcctgaccggcaaggtcgtgccctacaaggtcggcttcggt
cccttcccggccgaaatcttccatgtgcccttccccaacgcctatcgcggcatcagcgag
gcggagagcctgaaggcgctggacaccctgttcaagtccgacgtcgatccggcccgcgtt
gccgcgatcatcatcgagccggtgcagggcgagggcggcttcaacatcgccagcccgtcc
ttcctgcaggcgatccgcgcggtctgcgacaagcacggcatcgtcatgatcgtcgacgag
atccagaccggcttcgcccgcaccggcaagatgttcgccgtcgagcatgccgggatcgag
ccggacctcgtcaccatggcgaagagcctggccggcggcttcccgctgtcggcgctgacc
ggcaaggccgccctgatggacgccccgatccccggcggcctcggcggcacctatgccggc
agcccgctggcgaccaccgccgccctggccgtcatcaacgtcatcgaggaagagaagctg
gtcgaacgcgccgaaaagctcggcgagcgcatcgccggccgcttccgcaccatggcccag
cgcaacagcctgtcggtcatcggcgacgtccgcaacctgggcgccatggtcgccatggaa
ctggtgactgaccgcgagaccaaggagccggccgccgacctcaccaaggcgctggtcgcc
aaggccgccgagaagggcctgatcctgctgtcctgcggcacctacgccaacgtgatccgc
gtgctggttccgctgaccgcgtcggacgccctggtcgacgaaggcctggacatcatcgag
tgttccctggaagaactggtgtcggcgtaa

DBGET integrated database retrieval system