KEGG   Azospirillum lipoferum: AZOLI_p40658Help
Entry
AZOLI_p40658      CDS       T01658                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZOLI_p40658 (ahpF)
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AZOLI_p40658 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin AlaDh_PNT_C FAD_binding_3 DAO K_oxygenase Thi4 FMO-like NAD_binding_8 DUF3467
Motif
Other DBs
NCBI-ProteinID: CBS91010
UniProt: G7ZGN7
LinkDB All DBs
Position
AZO_p4:643593..645188
Genome map
AA seq 531 aa AA seqDB search
MLDANLKTQLKAYLERITHPITLVASLDDGAKSQEMLGLLEDIASLSDKITLDRNGADAR
RPSFAINRDGSDIGVTFAGLPMGHEFNSLVLALLQVGGHPSKESEELLEQIRNLDGDFRF
ETYFSLTCQNCPDVVQALNLMSALNPRIKHVAIDGALFQQEVEQRQVMAVPTVFLNGEPF
AQGRMDVAQIVAKLDTGAVARAAEKIKAKAPFEVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLAAALEQHVKDYEVDVMNLQTATALVPATQEGG
LIEVKLASGASLKSRTVVLSTGARWRSMNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLIEFDSQLRADAVLQRKLHSLPNVTVIVSAQTTEVHGDG
NKVVGLSYKDRNSGELKRVDLEGIFVQIGLVPNTEWLKGTLALTPRGEIEVDNRGQTSLP
GVFAAGDATTVPFKQIVIAMGEGAKAALAAFDHLIRTVPAEEAVRETVAAE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctgaagacgcagttgaaggcttacctggaacgcatcacccatccg
atcacgctggtcgcgtcgctggacgacggggcgaagtcgcaggagatgctcggcctgctg
gaagacatcgcctcgctgtcggacaagatcacgctggaccgcaacggcgccgacgcccgc
cggccctccttcgcgatcaaccgcgatggcagcgacatcggcgtcaccttcgccggcctg
ccgatggggcacgagttcaattcgctggtcctggcgctgctgcaggtcggcggccatccg
tccaaggagtccgaggagctgctggagcagatccgcaacctggacggcgatttccgcttc
gagacctatttctcgctgacctgccagaactgcccggacgtcgtccaggccctgaacctg
atgagcgcgctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgagcagcgtcaggtgatggccgtccccaccgtcttcctgaacggcgagcccttc
gcccagggccggatggacgtggcgcagatcgtcgccaagctcgacaccggcgccgtcgcc
cgcgccgccgagaagatcaaggccaaagccccgttcgaggtgctggtgatcggcggcggc
ccggccggcgccgcggccgccatctacgccgcccgcaagggcatccgcaccggcgtcgca
gccgagcggttcggcggtcaggtgctcgacaccatggcgatcgagaacttcatctccgtc
tcgcacaccgaggggccgaagctggccgcggcgctggagcagcacgtcaaggactatgag
gtcgacgtgatgaacctgcagaccgccaccgccctggtgccggccacgcaggaaggcggg
ctgatcgaggtgaagctggcgagcggcgcctcgctgaagtcccgcaccgtggtgctgtcg
accggcgcccgctggcgctcgatgaatgtcccgggcgaggcggaataccgcaacaagggt
gtcgcctactgcccgcactgcgacggaccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtcgaggcggccatcgacctcgccggcatcgtctcgcacgtc
acgctgatcgagttcgacagccagctgcgtgccgacgcggtgctgcagcgcaagctgcac
agcctgccgaatgtcaccgtcatcgtctcggcccagaccaccgaggtgcatggcgacggc
aacaaggtggtcggcctgtcctacaaggaccgcaacagcggcgagctgaagcgggtcgat
ctggaaggcattttcgtgcagatcggtctggtgcccaacaccgaatggctgaagggcacg
ctggcgctgaccccgcgcggcgagatcgaggtggacaaccgcggccagacctcgctgccc
ggcgtgttcgccgccggcgacgcgacgacggtgccgttcaagcagatcgtcatcgccatg
ggcgagggtgccaaggccgcgctcgccgccttcgaccacctgatccgcacggtgcctgcc
gaggaagccgtacgcgagaccgtcgcggcggagtga

DBGET integrated database retrieval system