KEGG   Azospirillum lipoferum: AZOLI_p50430Help
Entry
AZOLI_p50430      CDS       T01658                                 

Definition
(GenBank) Putative ribonuclease BN
  KO
K07058  membrane protein
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AZOLI_p50430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: CBS91416
UniProt: G7ZII7
LinkDB All DBs
Position
AZO_p5:458813..459745
Genome map
AA seq 310 aa AA seqDB search
MEYLRRWWAIVVDAAYGWINDDAMSMAASIAFYTIFSLAPLAILVIALAGLIFGDEAARG
ALVEQLSALVGREAGQTLQDLIARAGARETGLVASIVGIGTIIVGATTVFVELQTALNRI
WRVAAPEESTITWLVRVRLKALALIGAIGFLLIVSLVVSAALAAVGTWATGWATGWAAGY
VPAMPSLLWLFDMAVSWTVLTGLFAMIYRILPDTRIRWTDVWLGAAVNAFLFAVGKFLIG
FYIATSGVVTIYGAAGSFVLILLWVYYSAVIFLFGAELTRAYSERKGSRSHPPPIGRSNP
VPASSGSAAP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagtatctgcggcggtggtgggcgattgtcgtcgacgcggcctatggctggatcaac
gacgatgcgatgagcatggccgcgtccatcgccttctacaccatcttctcgctggcaccg
ctggcgatcctggtgatcgcgctggccgggctgatcttcggcgacgaggcggcacgaggc
gcgctggtcgagcagctgtcggccctggtcgggcgggaggccggccagaccctgcaggac
ctgatcgcgcgggccggcgcacgggaaaccggcttggtcgcgagcatcgtcggcatcggc
accatcatcgtcggcgccaccaccgtcttcgtcgagctgcagaccgcgctgaaccgcatc
tggcgggtggcggcaccggaggaatcgaccatcacatggctggtgcgggtacggctgaag
gcgctggcgctgatcggggcgatcgggttcctgctgatcgtctcgctggtggtcagcgcc
gccctggcggcggtcggcacctgggctaccgggtgggccaccggatgggccgccggttat
gtaccggccatgccgtcgctgttgtggctgttcgacatggcggtctcctggacggtgctg
accgggctgttcgcgatgatctaccggatcctgccggacacgcgcatccgctggaccgat
gtgtggctgggggccgcggtcaacgccttcctgttcgcggtgggcaagttcctgatcggc
ttctacatcgccaccagcggggtggtgacgatctatggcgcggccggatccttcgtgctg
atcctgctgtgggtctattattcggccgtcatcttcctgttcggggcggagctgacccgc
gcctattcggagcgcaagggcagcaggtcgcatcctcctcctatcggccgcagcaacccc
gtcccagcgtcatcaggatctgccgcgccttga

DBGET integrated database retrieval system