KEGG   Austrofundulus limnaeus (annual killifish): 106510985
Entry
106510985         CDS       T06063                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04068  FoxO signaling pathway
alim04110  Cell cycle
alim04115  p53 signaling pathway
alim04218  Cellular senescence
alim04310  Wnt signaling pathway
alim04340  Hedgehog signaling pathway
alim04371  Apelin signaling pathway
alim04510  Focal adhesion
alim04530  Tight junction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106510985 (ccnd1)
   04340 Hedgehog signaling pathway
    106510985 (ccnd1)
   04371 Apelin signaling pathway
    106510985 (ccnd1)
   04068 FoxO signaling pathway
    106510985 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106510985 (ccnd1)
   04115 p53 signaling pathway
    106510985 (ccnd1)
   04218 Cellular senescence
    106510985 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106510985 (ccnd1)
   04530 Tight junction
    106510985 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C PX
Other DBs
NCBI-GeneID: 106510985
NCBI-ProteinID: XP_013855175
UniProt: A0A2I4AI41
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLQTMLKAEENYLPSPNYFKCVQKDIVPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKVRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIHPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDSSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNGTTETKHVDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactctatcagaagagcctaccaggacgtc
aacctgctgaacgaccgagttctacagaccatgctgaaggcagaggagaactatctgccg
tcgccgaactactttaaatgtgtccagaaagacattgtgcccaaaatgaggaaaatacta
gctacatggatgttagaggtctgtgaggaacagaagtgcgaggaggaagtttttccgctg
gctatgaactatttggacagatttttatcagtggaggccaccaggaaagtgagactacag
ctgctcggagctacgtgtatgtttctagcatccaagatgaaggagaccgtgcccttaacg
gcygagaaactctgcatctacacagacaattcagtccttcctggagaactgctgcaaatg
gagcttctggttctcaacaagctgaagtgggatctggcttcagtcacgcctcacgacttc
attgagcacttcctgtccaagctgaagatccacccctccacaaagcagatcctcaggaaa
catgctcagaccttcgtggcgctctgtgctacagatgtcaacttcattgctagtcctcca
tccatggtggcggcgggcagtgtggtggctgctgttcaaggtctttacctgaagagccaa
gattcctccctgtcctcccagaaccttaccaacttcttgtcacaggtcattcgcagcgac
ccggactgcttacggtcgtgtcaggagcagatagagtccctgctggagtccagcctgcgg
caggctcagcagcacaacggtacaacagaaaccaaacacgtggacgaggaggtggacctg
tcctgcacgccgacagatgtgagagacgtcaacatttga

DBGET integrated database retrieval system