KEGG   Austrofundulus limnaeus (annual killifish): 106515158
Entry
106515158         CDS       T06063                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04020  Calcium signaling pathway
alim04260  Cardiac muscle contraction
alim04261  Adrenergic signaling in cardiomyocytes
alim04270  Vascular smooth muscle contraction
alim04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106515158
   04020 Calcium signaling pathway
    106515158
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106515158
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106515158
   04261 Adrenergic signaling in cardiomyocytes
    106515158
   04270 Vascular smooth muscle contraction
    106515158
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:alim04040]
    106515158
Ion channels [BR:alim04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106515158
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 106515158
NCBI-ProteinID: XP_013860265
UniProt: A0A2I4AXQ9
LinkDB
Position
Unknown
AA seq 2253 aa
MVNESKNMYIPEDTLENHQGSDYSPPPPLPRPPPAGLANEHRAGGSHGDHSGGGGGGANH
GVGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASGGGAGLGVGGGGPISTASSTQ
RKRQHYTTKPKKQTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCV
ALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLD
FIIVVVGLFSAILEQATKGDGANPIGGKTAGFDVKALRAFRVLRPLRLVSGVPSLQVVLN
SIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCFHNQTVAMAEEKPAPCAPDGA
YGRHCTQNGTKCQMGWVGPNEGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYEL
PWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDW
ITQAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTRLANRISKS
KFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHQQPQWLTDVQDIAN
KVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLR
CVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFD
ETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNY
ILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPEKRQENEKPPLEEKKSEK
IELKSITSDGETNTATKINMDDCCGDESEEKNPYPANDYIGDEDEDEPEMPVGPRPRPLS
DIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV
KNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLIS
SGIHLDFSKSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTL
LQFMFACIGVQLFKGKFFYCTDSSKQTQADCRGSYILYKDGDVTKPEKALRLWENSDFNF
DDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMM
NIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNS
TYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGY
FSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENARISITFFRLFRVMRLVKLLSRGEGI
RTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDHTQINRNNNFQTFPQAV
LLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEDCGSQFAIIYFVSFYMLCAFLI
INLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPP
LGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRA
IVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKT
ALSLQAGLRTLHDIGPEIRRAISGDLNVEEELDKGLKEPVSAASEDDIFRVKRSGGLFGN
HVNYYNQSDGRGSFPQSFTTQRPLHISQKGSPCKGESPSHEKLMDSTTFTPSSYSSSGSN
ANINNANNTGVTSVTTQGVSRFPSPSISTVDGHSGQPLTPILLPKSAWCFPPKSSESSDS
HLPIIQRGEGSTEETYDESYGDDREYQEDDHSLSSDMLVYHDETCKQLAPMEEAEEVEEQ
RGGRGWQSPRRVFLCPTTLGRRASFHLECLRRHSRPDISQKTAVPLHLVHQQALAVAGLS
PLLRRSHSPTLFSRLCSTPPASPTAQCSDASYQRVPSLRLEGANSHEKLNASLPSVNCGP
WYSDSNGNSPVSSPSPTPSVSGQRAPRPVSLTVPSLLGKDSSSLSHGSAGSLVEAVLISE
GLGHFAQDPSFIEATKAELADACDMTIEEMEHAANNILNTTTNATPSASSTSQHSPNGSL
PFHRAAAATHRDRAGGSSPAEDVAEAGGSRGYVHGPSSIEERQELLAPGSGREEEEEEAG
GREERHHRSPAVMAGALQRNSELLEDEECVTSL
NT seq 6762 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacatcccggaggacacccttgagaaccatcaaggc
tccgactactctcctcctccccctcttccccgccccccgccggccggcctggcaaacgag
cacagggccggcggcagccacggcgaccacagcggaggaggagggggaggggccaaccac
ggggtgggcgtggttggcctcgccccagagcacatccccacgccgggcgcggccctgagc
tggcaggcggccatcgacgcggcgaggcaagccaagatgatgggcaacgccgcgtcgggc
ggaggggcggggctcggggtgggagggggcgggcccatttccacggccagctccacgcag
aggaagagacagcactacactaccaaacccaagaagcaaaccacgacgacagccacgagg
ccgccacgggccctgctctgtctcacactcaagaaccccatccgaagggcctgcatcagc
atcgtcgagtggaaaccatttgagatcatcatcctgatgaccatattcgctaactgtgtg
gccttagctgtgtacatccctttccctgaggatgattccaacgccaccaactccaacctg
gagcgtgtggagtatctgttcctaatcatttttacagtggaggcgttcctcaaggtaata
gcttacggcctgctcttccaccccaatgcctacctgagaaacggctggaatctgctcgac
ttcatcatcgtagttgtagggttattcagtgcaattttggagcaggccacaaagggagac
ggggccaatcctattggagggaagacggcgggcttcgatgtcaaggcattgagggcgttc
agagtactccgaccccttagactggtctctggagtaccgagtttacaggtagtgttgaac
tccataatcaaagccatggttcccctgctccatattgccctcctggtcctcttcgtcatc
atcatctacgccatcatcggcctggagctcttcatgggaaagatgcacaagacctgcttt
cacaaccaaacagttgccatggcagaggaaaagccggcgccgtgcgcacccgacggagct
tacggccggcactgtacgcagaacggaaccaagtgccaaatgggatgggtgggtccaaac
gaggggatcaccaattttgacaattttgcctttgccatgctgacagtgttccagtgtata
accatggaaggctggacggacgtgctttactggatgcaggatgctatgggctatgagctg
ccatgggtctattttgtctctctcgtcatcttcggctcttttttcgttctcaaccttgtt
ctgggtgtgttgagcggagagttttccaaggaaagagagaaggccaaggcacgtggtgac
ttccagaaacttagagaaaaacagcaactggaagaagacctcaagggctatttagactgg
atcactcaggcagaagacatygacccagagaatgaagaggagggcttagacgatgacaaa
cccagaaacctgagcatgccggccagtgagaatgaatcggtgaacaccgataacgccccc
gggggagacgtggagggggagacctgctgcaccaggctggcaaataggatctccaaatcc
aagttcagtcgctactctcggaggtggaacaggttgtgtcggaggaagtgccgygcagca
gtcaagtcgcaggtgttttattggctggtcatcttcctggttttcctcaacacgctgacc
attgcttctgaacatcaccagcagccgcagtggctaactgatgtgcaagacattgctaat
aaagttttattggcactcttcaccggtgagatgctgctgaagatgtacagtctcggccta
caggcatactttgtgtcactcttcaatcggttcgacagcttcgtagtgtgcgggggcatc
ctcgagaccattctggtcgaaacaaagatcatgtctcctctcggcatttccgtgttacgt
tgcgtacgcttgctcagaatcttcaaaataaccagatactggaactctctttccaacctg
gtggcctcgctgctcaactcggtgcgctccatcgcctccctgctgctcctgctcttcctc
ttcatcatcatcttctcgctgctgggcatgcagctctttggggggaagttcaactttgac
gagaccaggcgaagcaccttcgacaactttccgcagtctctgctcaccgtgtttcagatt
ctaacaggagaggactggaactctgttatgtatgatggtatcatggcgtatgggggtccg
tcttttcctggcatgctggtctgcatctactttatcatcctcttcatctgcggaaactac
atcctgctgaatgtcttcttggccatcgctgtagacaatctggcagacgcagagagtctc
acatcggcccagaaagaagaggaggaggcgaaggagaggaaaaaactagccaggctcgcc
agtccagaaaagcgccaggaaaacgaaaagccacctctggaggaaaagaaaagcgagaag
atagagctgaagtccatcacctctgatggggaaaccaacacagcgacaaagataaacatg
gacgactgctgtggagatgaaagtgaagagaagaatccttatcctgctaatgattatatt
ggcgatgaggatgaggatgagccagagatgcccgttggtccgaggccccgcccactttct
gacattcagcttaaagagaaggctgttccgatgcctgaggcgcgcgcattcttcatcttc
agccacaccaacaagttcagggttctgtgccacaagattgtcaaccacaacatcttcacc
aacctcatcctcttcttcatcctgctaagcagcatcagtctggcagcagaggaccccgtc
aagaacgactccttcagaaatcagatcctgggctatgcagatcatgtcttcactggactc
ttcaccatagagatcattttaaagatgacagcatatggagccttcctccataaaggatca
ttctgcagaaactattttaacatcctggacttagttgtggtcagcgtttccctcatctct
tctggaatccacctagacttctcgaagtccagtgcaattaacgtggtgaaaatcctgaga
gtcctgcgagttcttagaccactgagagccatcaaccgggctaaaggactaaagcatgtg
gtgcagtgtgtgtttgtggccatcaggaccatcggcaacatcgtcatcgtcaccacgttg
ctccagttcatgttcgcctgtattggagtgcagctgtttaagggcaagttcttctactgt
accgacagctctaagcagactcaggcggattgcaggggttcttatatcctgtataaggac
ggggatgtgacgaagcctgaaaaggctctgagactctgggagaacagcgatttcaacttt
gacgacgtcctgcaaggaatgatggctctgttcgctgtgtccacttttgagggctggcct
gggttactgtaccgagccatcgactcccacgcggaggacgtcggccccatctacaactac
cgcgtggtcatctccatcttcttcatcatctacatcatcatcatcgccttcttcatgatg
aacattttcgtcggtttcgtcatcgtcacattccaggagcaaggagaacaagagtataag
aactgtgagctggacaaaaaccagcgtcagtgtgtggagtacgccctgaaggctcgccct
ctgcgccgctacatccccaagaacccttaccagtacaaggtgtggtacgtggtcaactcc
acctactttgagtacctgatgttcacactcatcctcctcaacaccatctgtctggctatg
cagcatcatgggcagaccaaaaactttaacgatgcaatgaacatcctcaacatgctcttc
accggactgtttacagtggagatgatccttaagctgatygccttcaaacccagggggtac
tttagtgatccctggaatgtgtttgatttcctcatcgtaattggcagcattatagacgtc
attctcagtgagatcaacggtcttcagaactctgaggagaatgccaggatctccatcacc
ttctttcggttgttccgtgtgatgaggctggtgaagctgctgtctcgtggggaggggatt
cggacactgctgtggaccttcataaaatccttccaggctctgccctatgtagctctgctt
atagtgatgctcttcttcatatacgccgtcattggcatgcagatgtttggtaagatagct
ctgcgggaccacacgcaaatcaacaggaacaacaatttccagacattccctcaggccgtg
ctgctgctcttcaggtgtgcgacaggtgaggcgtggcaggagatcatgctggcatgttca
cccaatcggccgtgtgagaagggctccaccaatgaaaacagcacagccagcgaggactgc
ggcagccagtttgccatcatttactttgtcagcttctacatgctttgtgccttcctgatc
atcaacttatttgtggctgtcatcatggacaattttgactacctgacgcgtgattggtcc
attctggggccgcaccaccttgacgagtttaagcgaatctgggcggagtatgacccagaa
gctaaggggaggataaaacacctggatgtggtcactctgctccggagaatccaacctcct
cttggcttcggaaagctctgtccacacagggtggcttgcaagcggctggtgtcgatgaac
atgcctctgaacagcgatggaaccgtgatgtttaacgcyacactgtttgctctggtcaga
acagcactcaggatcaaaacagagggtaatctggagcaggcaaatgaagaactgagggca
attgtgaaaaagatctggaaaagaaccagcatgaagcttttggatcaagtagtgccccct
gctggcgatgatgaggtgacagtcggaaagttttacgccaccttcctcatccaggaatat
ttccgcaagtttaagaagaggaaagaacagggactggtggccaaggtgccccccaaaact
gccctctctctgcaggcgggcctgcggacattgcacgacatcggtccagagatcaggagg
gcgatctctggagacctgaacgtggaggaggagctggacaaaggcttgaaagagcctgtg
tctgcagcatccgaggacgatatcttcagggtaaagcgttctggtggcctgttcggcaac
cacgtcaactactacaaccagagtgacggccgagggtccttcccgcagtccttcaccacc
cagcgtcccttgcacatcagtcaaaagggctccccgtgcaaaggagaaagcccgtctcat
gagaaactgatggactccaccaccttcaccccttcctcttactcctcatcgggctccaac
gccaacatcaacaacgccaacaacaccggcgtaacgagcgtgacaacccaaggggtcagt
cgattcccgagcccgtctataagcactgtggacggccacagcgggcaacccctcaccccc
atcctgctgcccaaatctgcatggtgcttccctccaaagagctcggagtcgagtgacagt
catctgccaatcatccagagaggggagggctccacagaggagacgtacgatgagagttat
ggtgacgacagggaataccaggaagatgaccactcactttcttctgacatgttggtgtat
catgatgaaacatgcaaacagctggctcccatggaggaagcggaggaggtcgaggagcaa
agaggaggacgaggatggcagtctccgcgaagagtcttcctctgcccaacaactctgggt
cggagagcgtccttccatttggagtgtctcaggaggcactcgagaccagatatctcccaa
aagacagctgtacccttacatcttgtacatcaacaagctctggcagtagcaggtttaagt
cctctgctgagaaggagccactcacccactctcttcagccggctgtgctccacgcctcca
gccagccccacagctcaatgtagtgatgcctcctaccagcgagttccctcgctgaggcta
gagggcgccaactctcatgaaaagctcaacgccagtttgccttctgtcaactgtgggccc
tggtacagcgacagtaatgggaacagcccagtatccagccccagccccacaccgagcgtg
tcgggtcaaagagcaccrcggccggtgtcgctaacggtgccctcgcttctggggaaagac
tccagttcgctgtcgcacggcagygcaggcagtctagtggaagcggttctaatatcagaa
ggtttgggtcatttcgcccaggacccgtcgttcatcgaggcgaccaaagccgagctggcg
gatgcttgcgacatgaccattgaggagatggagcacgccgccaacaacattctcaacaca
accaccaaygccacacccagcgcctcttccacctctcagcacagccccaacggcagcctc
cccttccacagagcagcagcagcgacacacagggaccgagccggcggctcaagccccgca
gaggacgtggccgaggccggcgggagccgaggctacgtccacgggccgtcctctatagag
gagcgtcaggagctgctagccccggggagtgggcgggaggaggaggaggaggaagcagga
gggagggaagaaaggcatcacagaagtccagccgtgatggcgggagcgctgcagaggaac
agcgagcttttagaggacgaggagtgtgtgacgagcttgtag

DBGET integrated database retrieval system