KEGG   Austrofundulus limnaeus (annual killifish): 106516091
Entry
106516091         CDS       T06063                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106516091 (tgfa)
   04012 ErbB signaling pathway
    106516091 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF EGF_2
Other DBs
NCBI-GeneID: 106516091
NCBI-ProteinID: XP_013861732
UniProt: A0A2I4B1Y4
LinkDB
Position
Unknown
AA seq 242 aa
MFWILWDALFLLGGPLFTFGTGPGSSTIVKANISIDSNSPAAPNSSSSNSLMAAGKDALT
TDIPTYKGSLVSSEPRWTHQTIIDATVSVNVTSAEETYNSTSSSRMSSTKRPAAANNHPV
KKFVAAAVRSHFDDCPDSHQHFCFHGTCRFLILEETAACVCHPGFVGLRCEHADLLAVVA
TNHRQQAVATVLVLCVIGCVLIMVLCSFLHCWWRQDCRRRSRAHLYVTEKNAASCYPPES
VV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgttttggatcctttgggatgctctgtttttgctgggcggtcctctctttacgtttgga
actggtcctggcagttcaacaatagttaaagccaacatttccatcgattcaaactctccc
gctgctccaaactcatccagcagcaactctttgatggctgctggcaaagatgctcttacg
actgatattcctacatataaaggttcgcttgtttcatctgaacctcggtggacgcatcaa
acgattatagatgctacagtttctgtcaatgtcacatctgctgaggaaacctacaattca
acaagcagcagcagaatgtcctcaactaaaagacctgctgcggccaacaaccatccagtt
aaaaagtttgtggcggctgctgttcgctctcattttgacgactgtccagactcccaccaa
cacttctgcttccacggcacgtgtcgcttcctgattctggaggagacggctgcgtgtgtg
tgccacccaggtttcgtggggttgaggtgcgarcacgcagacctgctcgctgtggtggcc
accaaccacaggcagcaggctgtcgctaccgtgctggtgctgtgtgtgatcggctgcgtt
ctcatcatggtgttgtgttccttcttacattgctggtggaggcaggactgtcggaggcgg
agtcgtgcacatctytatgtgacggaaaagaacgccgcatcctgctatccaccggagagt
gtggtttga

DBGET integrated database retrieval system