KEGG   Austrofundulus limnaeus (annual killifish): 106516114
Entry
106516114         CDS       T06063                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
alim  Austrofundulus limnaeus (annual killifish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5663 C1_2 VIR_N
Other DBs
NCBI-GeneID: 106516114
NCBI-ProteinID: XP_013861761
UniProt: A0A2I4B1Z3
LinkDB
Position
Unknown
AA seq 356 aa
MSRCELIELKDLSVDDPIELAAPASPAVGPGQPARRHAVRLLGDRVSIQVPSCHAGEGGV
GHDFQPYNYTHLTWCDLCGEFIWGLFKQSLRCANCSYTCHYRCRPLIQLDCSTHGGVLTQ
KTDDTEEAVETDTNVVKKKERKKERKKERKKERKVQPFNSHFSSGNLQNKNGSYTGFIKV
HFQLLRPISLPPPPPPPQRQNSTEEEDQQNRRVQRRTSFYLPKDAAKHLHISSETRVREV
IEALLRKFTVVDNPGKFALFERTEKQSQVCMRKLSEDERPLFLRLCAGPSETILSLVLKE
NETGDVNWDAFSLPELSNFLRILQREEEEHVRQIVKRYARARDVMKQAMTRITTPG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtctcgctgcgagctgattgagctgaaggacctgagcgttgatgatcccatcgagctg
gcagctcccgcctcgccggctgtaggtcccggccagcccgcccgccgccacgccgtccgc
ctgctcggagacagagttagcatccaggtgcccagctgccacgcgggggaggggggcgtg
ggacacgacttccagccctacaactacacacacctcacctggtgtgacctgtgtggagaa
ttcatctgggggctgtttaagcagagtttgcgctgtgccaactgcagttacacatgtcac
taccgctgccgaccgctcatccagctggactgcagcacacatggcggtgtgttgacacag
aagacagacgacactgaagaggccgttgagaccgacacaaatgtggtaaaaaagaaagaa
agaaagaaagaaagaaagaaagaaagaaagaaagaaagaaaggtgcaaccctttaactct
catttctcctctggaaacttgcagaacaaaaatgggtcctacactggtttcatcaaggtc
cactttcagctccttcgtcccatctcgctccctcctcctcctccgcctcctcagcgtcag
aactcgacagaagaggaggatcagcagaacagacgggtacagaggcggacgtctttttac
ctccccaaagacgcggcgaagcacctgcacatcagctccgaaacccgagtgcgggaagtc
atcgaggcattgctcaggaagttcacggtggtggacaacccaggaaagtttgccttgttt
gaacgcaccgagaagcaaagccaggtctgcatgcgtaagctgtctgaggatgagcgccct
ctgttcctgcgcctgtgtgccggccccagtgagaccatcttgagtctggttttgaaggag
aatgagacgggagatgtaaattgggatgcctttagccttcctgagttgagcaacttcctg
cgaatcctgcagcgtgaggaagaggagcacgtgcggcagattgtgaagcgctatgctcgc
gctcgagacgtgatgaagcaggccatgactcgcatcaccacacccggttga

DBGET integrated database retrieval system