KEGG   Austrofundulus limnaeus (annual killifish): 106516144
Entry
106516144         CDS       T06063                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04012  ErbB signaling pathway
alim04068  FoxO signaling pathway
alim04110  Cell cycle
alim04115  p53 signaling pathway
alim04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106516144
   04068 FoxO signaling pathway
    106516144
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106516144
   04115 p53 signaling pathway
    106516144
   04218 Cellular senescence
    106516144
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106516144
NCBI-ProteinID: XP_013861798
UniProt: A0A2I4B249
LinkDB
Position
Unknown
AA seq 172 aa
MCRIMATAHKRILSPLRRSGPTRRSLFGPVDREQLQVEYQAALSKDLEEASKRWGFDFIS
GKPLESGDFQWEGVLDSRVPLLYRSCVPNVKPTRGQRPASSMASTKRARAASPESEKENI
PQTPENRLLNLEDVEKTPEKGDRTGLKRKQTNITDFYQAKRRIVWMPRKSGE
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtgcagaatcatggctacagctcacaagcgcatcctgagcccgctgaggagaagcggg
cccacccgacgcagcctgtttggcccagtggaccgagaacagctccaggtggaataccag
gccgccctgagtaaagacctggaagaggcgtctaaacgctggggcttcgacttcatctcg
ggcaaacccctggagagcggtgacttccagtgggagggcgtactggactccagggtgccg
ctgctctacagatcctgtgtgcccaacgttaaaccgacacgaggtcaaaggccagcgagc
tcaatggcatcaaccaaaagagcaagggcggcgtcgccagagagcgagaaggagaacatc
ccccaaacaccagagaaccgcctgctgaacctggaagacgtggagaaaacgccagagaag
ggagacagaacaggactgaagaggaaacagacaaacattacagatttctaccaggctaag
aggcgaatagtttggatgccgaggaaatccggcgagtga

DBGET integrated database retrieval system