KEGG   Austrofundulus limnaeus (annual killifish): 106516191
Entry
106516191         CDS       T06063                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
alim  Austrofundulus limnaeus (annual killifish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 106516191
NCBI-ProteinID: XP_013861869
UniProt: A0A2I4B288
LinkDB
Position
Unknown
AA seq 365 aa
MSWGEFIELRDLRSSREPAELADARSPCSPPRLERTNALRISPGRVPDLLSRVGIIRVLS
STQDPQLPEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
RLDCSWDRGSVADHTXVVEHTVETDTNVDEQTDSVKEELTTAEVLQKVKEYNAQINSNLF
MNMNKDGSYTGFVKVQFKLARPVSVPAPKKGGHDVGGRRASGVKRRTSFYLPKDASKHLH
ISSRTTSREVIEALLKKFTVVDNPGKFALFQRSERHDQVYVRKLSDEERPLRLRLCSGPN
EKVLSFLIKENETGEVNWHAFSMPELKNFLLILHREEEEHVKQIVQRYASARAKMQEALS
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggcgagttcatcgagctgcgtgacctgaggtcgagcagggagccggcagag
ctagcggacgcccgttcgccgtgctcgcctccgcgcctggagcggacgaacgccttgagg
atcagccccggaagggttccggacctcctgagccgggtgggcatcatccgggtcctgagc
agcacccaggacccccagctcccggaggagaagggcgaagggcacaacttccagccctgc
agccacgctcagcccacgtggtgtgacctgtgtggagacttcatctggggcctttacaag
cagagcctgcggtgtgtcaactgcagatttacgtgtcactatcgatgtcgtgccctgatt
cgtctggactgcagctgggaccgaggctctgtggctgaccacaccrgtgttgtggagcac
actgtagagacagacacaaatgtggatgaacagaccgattcagtaaaagaggagctgacg
acagcagaagttttacagaaggtcaaggagtacaatgctcagatcaacagtaatctgttc
atgaacatgaacaaagatgggtcctacactggcttcgtyaaggtgcagttcaagctggcg
cggcccgtgtcggttccggctccaaagaaaggaggccacgacgtcggagggaggagggcc
agcggggtgaagcgtcgcacttccttctacctgccaaaggatgcgtccaagcatttgcac
ataagctcccgcactacttctcgtgaggtcatcgaggctttgttgaagaagttcaccgtg
gtggacaatcccggcaagtttgcactgtttcagcgcagcgagcgccatgaccaagtttat
gttcgcaagctctctgatgaagagcgccccctccgccttcgtctgtgttctgggccaaat
gaaaaagtcctcagttttttgatcaaagaaaatgaaactggtgaagtcaattggcatgcc
ttctccatgcccgagctgaagaacttcctgctcatcttgcaccgtgaagaagaggagcac
gtcaagcagatagtgcagcgctacgcctcggctcgtgccaagatgcaggaggctctgtcc
ggctcgacccccggctga

DBGET integrated database retrieval system