KEGG   Austrofundulus limnaeus (annual killifish): 106518714
Entry
106518714         CDS       T06063                                 

Gene name
pdgfa
Definition
(RefSeq) platelet-derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04020  Calcium signaling pathway
alim04510  Focal adhesion
alim04540  Gap junction
alim04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106518714 (pdgfa)
   04020 Calcium signaling pathway
    106518714 (pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106518714 (pdgfa)
   04540 Gap junction
    106518714 (pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106518714 (pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106518714 (pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:alim00536]
    106518714 (pdgfa)
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106518714 (pdgfa)
Glycosaminoglycan binding proteins [BR:alim00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106518714 (pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 106518714
NCBI-ProteinID: XP_013865555
UniProt: A0A2I4BCT6
LinkDB
Position
Unknown
AA seq 210 aa
MRTALCYFLLWTSYLLAAAEEAEFPQELLDRLSNSEIHSISDLQRLLEIDSVGTGNDVIE
EHKYRKHHNHHNHHKNFSQHQSYYNGLKSSQLHSRRKRSIVEEAVPAVCKTRTVIYEIPR
SHVDPTSANFLIWPPCVEVKRCTGCCNTSNMRCHPSRKHHRTVKVAKVEYVRRRPKLKEV
FVRLEDHLECMCTLQHHVVEHLDSETVDVR
NT seq 633 nt   +upstreamnt  +downstreamnt
atgagaaccgcactttgttacttcctgctgtggacgtcgtacctgctggccgcagctgag
gaagcggagtttccccaggagctgctggaccgactctcaaacagtgaaatccacagcatc
agcgacctccagcggttactggagatagactccgtaggcacgggaaatgatgtcattgag
gagcacaagtaccgcaaacaccacaaccaccacaatcaccacaagaacttctctcaacat
caaagctactacaatggcctgaagagctctcagctacacagcagacgcaagaggagcatt
gtcgaggaggcggtcccggcggtgtgcaaaacacgaacggtgatctatgagatccccagg
agccatgtggatcccacatctgccaatttcctgatatggccyccctgtgtggaggtgaag
cgctgcacaggctgctgcaacaccagcaacatgcgctgtcacccatcccgcaagcaccac
cgcacggttaaggtagccaaggtggagtatgtgaggaggagacccaagctcaaagaggtc
tttgtacgattagaagaccacctggagtgtatgtgcacattacaacatcatgtggtagag
cacttagactcagaaacagtagatgtgaggtga

DBGET integrated database retrieval system