KEGG   Austrofundulus limnaeus (annual killifish): 106519273
Entry
106519273         CDS       T06063                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04060  Cytokine-cytokine receptor interaction
alim04068  FoxO signaling pathway
alim04144  Endocytosis
alim04218  Cellular senescence
alim04350  TGF-beta signaling pathway
alim04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106519273
   04350 TGF-beta signaling pathway
    106519273
   04068 FoxO signaling pathway
    106519273
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106519273
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106519273
  09143 Cell growth and death
   04218 Cellular senescence
    106519273
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106519273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:alim01001]
    106519273
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106519273
Protein kinases [BR:alim01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106519273
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 106519273
NCBI-ProteinID: XP_013866312
UniProt: A0A2I4BEZ6
LinkDB
Position
Unknown
AA seq 581 aa
MQGPRCSSSLRTTFLVLALLQLGTSDAMFFGSNNQLCMFCDLQPSDCNGTGTCSTNCSIS
SICEKASEICVSIWRKNETGFSVETLCHDPIIPLYGILLDDYNSTTCVMKERNLTSGMAY
VCSCSDEEECNDILLFTSTVAQTPADPLMSVILVSLLPLLVTGIVVAGMFYWYWVHRRRQ
LSQEWERKLKLRKPKSGGLDCSDACAIMVDDDGSDSSSTHANNLNHNTEPLPIELDQLVG
KGRFAQVYKAKLKQTTSNQFETVAVKIFPYEEYASWKNEKDIFSNTELRHENILHFLTAE
ERKVEKQYWLITAFHSRGNLQEYLTHHVVSWEELQVLSSSLAQGVAHLHSDRLPCGRPKV
PIVHRDLKSSNILVKNDLTCCLCDFGLALCLDSSLTVDDLANSGQVGTARYMAPEVLEAR
LNLENIESFKQTDIYSMALVLWEMTSRCKAIGEVKDYEPAFGSKEREHPCVESMKDSVLR
DRGRPEILDSWLRHQGVAVICATMKECWDHDPEARLTAHCVAERLAELEDELDKLSSRSS
SAEKILEELKRPIAVDIPVEEVKISQIQSIIAVDSSMSDKK
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagggaccgcgctgctcttcgtctttacgcacaaccttcctggttttggcgctgctg
cagctcgggacctccgatgcgatgttcttcggcagcaacaaccagttatgtatgttctgt
gacctgcagccttccgattgtaacggcacagggacgtgctccaccaactgctccatctca
tccatctgtgaaaaggccagtgaaatctgtgtctccatctggaggaagaacgagacrggc
ttctccgtggaaactctgtgccatgatcccatcatcccactgtacggcattctgctggac
gactacaacagcaccacctgcgtgatgaaggagaggaatctgacgagcgggatggcgtac
gtttgctcctgttcagatgaagaggagtgcaacgatattctgctcttcacttccactgtt
gctcaaactccagcggacccgttgatgtctgtaatcctggtcagccttctgcccctgctg
gtgacagggattgtggttgctgggatgttctactggtactgggttcatcggcgtcgccag
ctcagtcaggaatgggaaagaaaactgaaactgcgcaaacctaaatccggaggtctggac
tgcagcgacgcctgtgccatcatggtggacgacgacgggtcagacagcagttccactcac
gctaacaacctaaaccacaacactgagccgctgccaatagagctggaccagttggtgggc
aagggtcgctttgctcaggtatataaggctaaactgaagcagaccacctcaaatcagttt
gaaacggtggcggtgaaaatcttcccctacgaggagtacgcctcttggaagaacgagaag
gacatcttctccaacacagagctgcgccacgagaacatcctccacttcctcacagctgag
gagaggaaggtggagaaacagtactggctcatcacggctttccactccagaggaaacctt
caggagtacctgacacatcatgtcgtcagctgggaggaactgcaagtgttgagcagctct
ctggcccaaggggtcgcccacctccacagtgaccggctgccctgtggacgtcctaaggtg
cccattgtccacagagacctgaagagctccaacatcctggtgaagaacgacctgacctgc
tgtctgtgtgactttggtctggctctctgtctggacagcagcctgactgtagacgatctc
gccaacagcggacaggtgggaactgcacgttacatggcccccgaggtgctggaggcccga
ctcaacctggagaacatcgagtccttcaagcagacggacatttactccatggcgctggtg
ctgtgggaaatgacatccagatgtaaagctattggagaggtgaaggactacgagccggct
tttggctctaaagaacgagagcacccctgtgtggagagcatgaaggacagcgtgctgcga
gatcgagggaggccggagatcctcgacagctggctcagacaccagggagttgcagtgatc
tgtgccaccatgaaggagtgttgggaccatgaccctgaagcccgcctcacggcccactgc
gtcgctgagcgtctcgctgaattggaggatgagctcgacaaactgtccagccggagctcc
tcagcggaaaagatcctggaggagctaaagagaccaatcgcggtggacatcccggtggag
gaggtgaaaatcagtcaaattcagagcatcatagctgtggacagctccatgagcgacaag
aagtga

DBGET integrated database retrieval system