KEGG   Austrofundulus limnaeus (annual killifish): 106520044
Entry
106520044         CDS       T06063                                 

Gene name
vegfa
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04020  Calcium signaling pathway
alim04370  VEGF signaling pathway
alim04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106520044 (vegfa)
   04370 VEGF signaling pathway
    106520044 (vegfa)
   04020 Calcium signaling pathway
    106520044 (vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106520044 (vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106520044 (vegfa)
   00536 Glycosaminoglycan binding proteins [BR:alim00536]
    106520044 (vegfa)
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106520044 (vegfa)
Glycosaminoglycan binding proteins [BR:alim00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106520044 (vegfa)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 106520044
NCBI-ProteinID: XP_013867411
UniProt: A0A2I4BI49
LinkDB
Position
Unknown
AA seq 227 aa
MNFIDSLTLLFLTLSAVKSAHIPKEAERGPHDAIPLMEVYNKSLCQPREVLVDILQEYPE
EVEHIFIPSCVVLKRCAGCCVDEMLQCTPTVTYNVTMEIKRIKLQRQQNNIFMSFTEHSA
CECRSKTEVKEKPPGKGKGKGQKKKRKKNRDKTIHDAVCEPCCDNCTERRKRLFVQDPAT
CRCSCKHTVEYCKDRQLELNEKTCKKSNNLPLAFYSQNSSRCDKPRR
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaactttattgacagtttgactctactatttttgacgctgtcagctgtcaagagtgcc
cacataccgaaggaagcagaaagaggtccacatgacgcgatccctttgatggaggtgtac
aacaagagtttgtgtcagccgcgggaggtgctggtggatatcctacaggagtacccggag
gaggtggaacacatctttatcccgtcctgcgtggtgttgaagcgctgcgccggctgctgc
gtcgacgagatgttgcagtgcacgccgacggtcacctataacgttacaatggagattaaa
agaataaagctccaaaggcaacaaaataacattttcatgagttttacagagcacagtgca
tgtgagtgtaggtcaaagacagaagtaaaagaaaaaccacctgggaaaggcaagggcaaa
ggccaaaagaaaaagcgaaagaaaaaccgcgacaaaacaattcacgatgctgtctgtgag
ccatgttgtgataactgcacagagcggagaaagcgtttgtttgtgcaggatccagcaacc
tgccggtgctcctgcaaacacacagttgaatactgtaaagatcgccagctagagctcaac
gagaagacctgcaagaaatcaaataacttgccacttgccttctactcccaaaactcctca
agatgtgacaagccaagaagatga

DBGET integrated database retrieval system