KEGG   Austrofundulus limnaeus (annual killifish): 106520545Help
Entry
106520545         CDS       T06063                                 

Definition
(RefSeq) caskin-2-like
  KO
K21952  CASK-interacting protein
Organism
alim  Austrofundulus limnaeus (annual killifish)
Brite
KEGG Orthology (KO) [BR:alim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:alim04131]
    106520545
Membrane trafficking [BR:alim04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106520545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 SH3_2 Caskin1-CID SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 106520545
NCBI-ProteinID: XP_013868175
UniProt: A0A2I4BKA0
LinkDB All DBs
Position
Unknown
AA seq 448 aa AA seqDB search
MGKEQDLLVAVKNGDLLQTHKLLSKLKCNKTKLLGTNKRLNINHQDLDGFSALHHAALTG
TTELLSLLLEAQATVDIKDINGMRPLHYAAWQGKSDSVLLLLRAGASVNSPSLDGQIPLH
LSAQYGHYEVSEMLLQHQSNPCLMNKARKTPLDLACEFGRLKVAQLLLSSNMVTTLLEGE
RGNDTLDPSSTTPLHLAARNGHKDIIKLLLKAGIDMNRATKAGTALHEAALYGKMEVVQL
LLDAGINVNIRNTYNQTALDIVNQFTTSTASREIKQLLREASCCLQVRAVKDYWNLHDPT
ALNLQAGDLIMVLEQHSDGRWKGHVHDSQRGTDRVGFFPPSVVEVLSRRSGGSLSRQASM
PCQRQHFVSRTPPLGPATQTDDSYILGYDPTGDRNSVGSTGSAGSSRSAGSGQSSESGHK
QNGTHNRHHHDTVKLAPSAGETRDQNKR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggaacaagatcttctggtggcggtgaagaatggagatctgctgcagactcac
aagctgctttccaaacttaagtgcaacaaaaccaagttactgggtaccaacaagagacta
aacatcaatcaccaagacttggatggcttctctgcgctgcaccacgctgctctgaccggg
accaccgagctgctgtctctgctgctggaggcccaggccacagtggacatcaaagacatc
aacgggatgcgtccgctccattatgcagcctggcagggtaaatctgactcggtcttactg
ctgctgagagccggtgcttcagtcaactccccttcacttgacggacagatccccttacac
ctgtctgcacagtatgggcactatgaggtgtccgagatgctgctgcagcaccagtccaac
ccctgcctcatgaacaaggcgaggaagactccgctggatttggcctgtgagttcggcaga
ctgaaggtggctcagctgttactcagcagtaacatggtgacaacactgttagaaggagag
cgagggaacgataccctggacccatcctccaccacccccctccacctggcagctaggaat
ggacacaaagacatcatcaagttgctgctcaaagctggcatcgacatgaacagagccacc
aaggcagggaccgctctgcacgaggctgccctctatgggaagatggaagtagtgcaactg
ctgctggacgctggcatcaacgtgaacatacgcaacacatataaccagacagctctggat
attgttaaccagttcaccacctctacagccagcagggagatcaaacagctcctcagagaa
gcctcgtgttgtcttcaggtcagagcggtgaaggactactggaacctccacgaccccaca
gctctgaacctgcaggccggagatctgatcatggtcttggagcagcactcagacggccgg
tggaaaggccacgttcatgacagtcagcgagggacggaccgggtgggcttcttcccccct
tcagtggtggaggtcctcagcagaagatcaggcggcagtctttcccgccaagcctcaatg
ccttgccagcgacagcactttgtatccagaactcctccgttaggccccgccacccagacg
gacgactcgtacatcctcggctatgatcccacaggtgacaggaacagtgtcggcagcact
ggcagcgccggcagcagtcgcagcgccggcagtggtcagagctctgagagtggccacaaa
cagaatggaacccacaaccgccaccaccacgacacggtgaagctggcgccctctgctggt
gaaactagagaccaaaacaagaga

DBGET integrated database retrieval system