KEGG   Austrofundulus limnaeus (annual killifish): 106521770
Entry
106521770         CDS       T06063                                 

Definition
(RefSeq) uncharacterized protein LOC106521770 isoform X1
  KO
K05461  KIT ligand
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106521770
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106521770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106521770
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106521770
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106521770
NCBI-ProteinID: XP_013869935
UniProt: A0A2I4BQA2
LinkDB
Position
Unknown
AA seq 259 aa
MRVTCIFYLQIFNTTCFLLSLFSTLSLCSGKFGTPITDDVNKLSVLKQNIPSDYEIPVTH
IPKEVAGTCWVVLNIYPLEQSLRKLANMFGTVSSNKDNIMVFIAMLKSLRFTFDHGELET
AMQVFRCHYQEETLQSGLYFDYIQDLLQAATQGKSSLSCKPPPCRNQQLTPEGQEEGRRQ
SWSKRAPLLLVLIPFIACVVLIVWQVKSGGRLMACNTLNGQMATPDMIPTVSISIPLQTL
THAADSQPAGEAISEHESG
NT seq 780 nt   +upstreamnt  +downstreamnt
atgcgtgtgacctgtatcttttatctccagatcttcaacacaacttgtttcctcctaagt
ttgttttccactttaagtctctgctctggaaagttcggaacaccgataactgacgatgtg
aacaagctgtcagtgttgaagcagaatatcccctctgattatgagattcctgttacccac
attcccaaagaagtggctggcacatgctgggtggttttaaatatctatccactggagcaa
agtcttcgaaagctggccaacatgtttggtaccgtctcctccaacaaagataacataatg
gtgtttatcgcgatgctcaagagcctgcgcttcacctttgaccacggggaacttgaaacg
gcgatgcaggtcttccgctgtcactatcaggaagagaccttgcagtccggtctttacttc
gactacatccaagacctcttgcaggctgccactcaaggaaaatccagcctctcgtgcaag
ccgccaccgtgccgcaatcagcagctaacgccagagggtcaggaggagggtcgcagacaa
agctggtcaaagagagctcccctgcttttggtgctgatcccctttatagcctgcgttgtt
ctcatagtgtggcaggtcaagtccggaggccgtttgatggcgtgcaacactttaaacggc
caaatggcaactcctgacatgatcccaactgtgtctatctccatcccacttcaaacactc
acccacgccgctgacagtcagccagcgggggaggcaatctcagaacatgaaagtggatga

DBGET integrated database retrieval system