KEGG   Austrofundulus limnaeus (annual killifish): 106522509
Entry
106522509         CDS       T06063                                 

Definition
(RefSeq) platelet-derived growth factor subunit A-like
  KO
K04359  platelet-derived growth factor subunit A
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04020  Calcium signaling pathway
alim04510  Focal adhesion
alim04540  Gap junction
alim04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106522509
   04020 Calcium signaling pathway
    106522509
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106522509
   04540 Gap junction
    106522509
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106522509
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106522509
   00536 Glycosaminoglycan binding proteins [BR:alim00536]
    106522509
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106522509
Glycosaminoglycan binding proteins [BR:alim00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106522509
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 106522509
NCBI-ProteinID: XP_013870994
UniProt: A0A2I4BTF5
LinkDB
Position
Unknown
AA seq 197 aa
MKAAVYHLLAGFCCLLRTAAEESPLPQELLDRLSRSEIRSISDLQRLLEIDSVENEVMEE
TKHSYSKDLSHSFPDHKNTHARQKRSTEVEEALPAACRVRTIIYEIPRSQVDPTSANFII
WPPCVEVKRCTGCCNTSNMRCHASRQTHRTVKVAKVEYVRRRPKLREVQVMLVDHLECVC
TNKHHISPNSDTDNGIR
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaaagccgcggtctaccacctcctcgccggattctgttgccttttacgtaccgctgct
gaggagtctcctctaccccaggagctgctggatcggctctcccgcagcgagatccgcagc
atcagcgacctccagcggctgctagagatagactccgtagagaacgaggtgatggaggag
accaaacacagctacagcaaggacttgtctcacagcttccccgatcacaagaacacacac
gcaagacaaaagaggagcactgaagtggaagaagccctgcccgcagcgtgcagagttcgc
actataatttacgaaatccccaggagccaggtggatcccacttcggccaacttcatcatc
tggcctccctgcgtggaggtgaaacgctgcaccggctgctgcaacacgagcaacatgagg
tgccacgcgtcccgtcaaacccaccgaacggtcaaggtggcraaggtagaatacgtacga
cggcggccgaagctgagggaggtgcaggtgatgttggtggaccacttagagtgtgtatgc
accaacaaacaccacatcagcccaaattcagacacagacaatggcatcaggtga

DBGET integrated database retrieval system