KEGG   Austrofundulus limnaeus (annual killifish): 106523021
Entry
106523021         CDS       T06063                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04210  Apoptosis
alim04620  Toll-like receptor signaling pathway
alim04621  NOD-like receptor signaling pathway
alim04622  RIG-I-like receptor signaling pathway
alim04623  Cytosolic DNA-sensing pathway
alim04625  C-type lectin receptor signaling pathway
alim04920  Adipocytokine signaling pathway
alim05132  Salmonella infection
alim05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106523021 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106523021 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106523021 (ikbkg)
   04621 NOD-like receptor signaling pathway
    106523021 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    106523021 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    106523021 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    106523021 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106523021 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106523021 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106523021 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:alim01001]
    106523021 (ikbkg)
Protein kinases [BR:alim01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   106523021 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 106523021
NCBI-ProteinID: XP_013871756
UniProt: A0A2I4BVH6
LinkDB
Position
Unknown
AA seq 592 aa
MVQPQPDGPMQWDMSGEDSGGALRVPPELAGNEVVTRLLCDNQQLREALRRSNLALRQRC
EEMEGWQRKTREEREFLSCRFQEARALVERLAQENHSLHSMVNLPAASASNHCCNSSQTE
DLQGRPAKNGPVEGPQTLDQWERKRVEDTEQQTQTTPLRSLPVEGANEFLQLLKTHKEEM
KEGTRELRRKNEELEWKNGELERKMEEGEVEKERMRRCIDQLRAKLLQVQXSGGSEETVQ
LRAEAQHSSDCFGLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCA
QLAKDCEALKAQATSLLGELNERQSCLEKSEYERKILEEKLVGKVKALQAAERELEQQKT
QHNVAMDKLLLQVQGLEQALKTERHTVTEEKKKLTQLQHAYTCLFRDYDSKLKNEEGDLS
SRLEEAERALALKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQ
KKEELQEELNKAVTEIERLNQDLLSRERMEQMKKRHVKDFPQRPVLIPPPQGMFPAGAFN
TVPPAQSFRNQVPVNDRGAPGAEELPDLCCPKCHYLAPDMDTLQIHVMDCIQ
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggtgcagccccagcctgatggtccgatgcagtgggacatgtcgggggaggacagcggg
ggggccctcagggtcccaccagagctcgctggcaacgaagtggtgaccagactgctgtgc
gacaaccagcagctccgagaggctctgcggcggagcaacctcgccctgcgtcagcgctgc
gaggagatggagggctggcagcggaaaaccagggaggagcgagaattcctcagctgccgt
ttccaggaggcccgggcgctggtggagcggctggcccaggagaaccactccttacacagc
atggtcaacctgccggcggcgtcggcctccaatcactgctgcaactccagccagaccgaa
gacttgcagggacgccccgccaaaaacgggccggtagaggggccgcagactctggatcag
tgggagagaaaacgggtcgaggacacggaacagcaaacccaaaccactccgcttcgcagc
ctgccagtggagggcgcaaacgagttcctgcagctgctgaagacccacaaggaggagatg
aaggagggaacgagggagctcaggaggaagaatgaagaactggagtggaagaacggagag
ctggagaggaagatggaagagggagaggtggagaaggagcgaatgcgccgctgcatcgac
cagctccgagccaagctgctgcaggtgcaggygagcggcggctctgaagaaaccgttcag
cttcgcgctgaggcgcagcattcctccgactgttttggcctggctaaactcacagagcag
cttcaggccacacagggcaggtatcgggagctggaggagaagctggattacctgcagaag
agctctgctcagcgggaccggacagaagctctgctcaaacagaaggacaaggactgtgct
cagctggccaaagactgcgaggccctgaaagcccaggcaacctccctgctaggagagctg
aacgagaggcagagctgcctggagaaaagcgagtacgagcgcaaaattctggaggagaag
ctggtgggtaaggtgaaggcactgcaggcggcggagcgagagctggagcagcagaagacg
cagcacaacgtggccatggacaagctgctgctgcaggtccagggtctggagcaggccctg
aagacggagaggcacaccgtcactgaggagaagaaaaaactgacccagctgcagcacgcc
tacacgtgtctgttcagagactacgattccaaactgaagaacgaggaaggagacctcagc
agccgactggaggaggcggagcgggcgctcgccttgaagcaggacctgatcgacaaactg
aaggaggaggtggagcaacagaaaggctcgctggagaccgtccctgtcctgaccgcgcag
gcggagatctacaaggccgatttccttgcagagcgagaagcgcgagagaagctgaaccag
aagaaggaggagctgcaggaagagcttaataaggccgtgaccgagatcgaaaggctcaat
caggatctcttatcacgtgaacgtatggagcagatgaagaagagacacgtgaaagacttc
ccccagcgacccgtcctcattccccctccgcaaggaatgtttcctgcaggagccttcaac
acagtccccccagcccagtctttccggaaccaggtaccagtcaacgatcgaggagcacca
ggagccgaagagcttcccgatttatgttgcccgaagtgtcactacctggctccagacatg
gacacgctgcagatacatgtcatggactgtatacagtaa

DBGET integrated database retrieval system