KEGG   Austrofundulus limnaeus (annual killifish): 106523408
Entry
106523408         CDS       T06063                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106523408
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106523408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106523408
   00536 Glycosaminoglycan binding proteins [BR:alim00536]
    106523408
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106523408
Glycosaminoglycan binding proteins [BR:alim00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106523408
SSDB
Motif
Pfam: FGF Fascin eIF-6
Other DBs
NCBI-GeneID: 106523408
NCBI-ProteinID: XP_013872262
UniProt: A0A2I4BWZ4
LinkDB
Position
Unknown
AA seq 177 aa
MAQQGCCHMTFSQGHRSALSMPHTRRGMFEGDVTVLPFGSSPADLSKQHPLIRLYSQNGG
YHLRISPDGAVSGGRQEDDPYEILRLTAVSVGVVVIKGETTGRFLAMNKNGCLYGSQAMN
DECHFLEKYEXNNYNSYRSQKYSWFVALKRNGQPKKGPDTHQGQKAIFFLPRPAGTV
NT seq 534 nt   +upstreamnt  +downstreamnt
atggctcagcagggctgctgtcacatgactttctcacagggacatcgctctgctttatca
atgcctcacactcgacgtgggatgtttgagggagacgtcacggtgctgccgttcggctcc
tctcctgcagacctgtccaagcagcaccccctgatcaggctgtacagccagaacggaggt
tatcacctgaggatttcaccagatggagctgtgagtggtgggaggcaggaagatgatcct
tacgagatcctgaggctgactgctgtaagcgtgggagtggtggtcatcaaaggcgagacc
acgggacggttcctggctatgaacaaaaacggatgcctttatggatcacaagcaatgaac
gatgagtgtcacttcctggagaagtacgaggasaacaactacaactcgtaccgctcgcag
aaatacagctggtttgttgctttaaaaaggaacggccagcctaaaaagggaccggacacc
caccagggtcaaaaggccatctttttcctgcccaggcctgctggcactgtgtaa

DBGET integrated database retrieval system