KEGG   Austrofundulus limnaeus (annual killifish): 106523434
Entry
106523434         CDS       T06063                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106523434
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106523434
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:alim03310]
    106523434
Transcription factors [BR:alim03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    106523434
Nuclear receptors [BR:alim03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   106523434
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR DUF5407
Other DBs
NCBI-GeneID: 106523434
NCBI-ProteinID: XP_013872303
UniProt: A0A2I4BX24
LinkDB
Position
Unknown
AA seq 805 aa
MFFSLQNEEMDQGGPKHNGNQNNNLTFGEIAPELGRDTSALLLQSTMHLPGPGNQTQSTL
APNGQGGTKDQGNFGGIFESPHLHAPCEGSDKEAKRIRMQKQEQDIFSIGDNLSLLNQNI
SDLNQTSTSIITTSESSVLGNLPLPDLFPQQIKQERVFSMDKDLGNYCGQTGAGSSNLDG
SSQLIDDSEIWQDLDLSSSLPEISDFELDSEVAHLDNILQENSLGGGSIIGLPKETKPLL
GNGENCTSVNGMEQQRRHPMQQQQPPQHLVQHQQHALQPQQSPTMISGVVIKEEKDPDFI
HLSTPGVVKLERQDSAGYCQSQCLQGGMGSLHGGGAGSMSSPMGVGAGPSYSYGASQPST
VNLPDQKPFGAFSTLPGVGESWLGGKRYGESSGIPSGSDGLQSAAALANFPVSFSSTSTR
TGEPSSTVVSGQSKPGGQGQKVCLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNT
DGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLDARKNKKLHKVRPQRPPGPPE
PVNLPIPVIPKNLPQLVPTMLSVLKAIEPEIIYSGYDSTLPDTSSRLMSTLNRLGGQQVI
SAVKWAKSLPGFRSLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGKMLCFAPDLVINKE
RMNLPLMDDQCKQMLKICNEFVRLQVSYEEYLCMKVLLLLSTVPKEGLKSQAIFDEIRMT
YIKELGKAIVKREENTSQNWQRFYQLTKLLDSMQEMVEGLLQICFHTFVNKTLSVEFPEM
LAEIITNQIPKFKDGSVKPLLFHQK
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgtttttctcactacagaatgaagaaatggatcagggtggaccaaagcacaacggtaat
cagaacaacaacctgacatttggggagatagcacctgaattaggcagagatacgtccgct
ttattgctccagtctacgatgcatctgcccggtcccgggaatcagacccagagtacgcta
gccccgaacggacagggtggaacaaaagaccaggggaacttcggaggcatctttgagtca
cctcaccttcatgctccatgtgagggatccgataaggaggctaaaaggatcagaatgcag
aaacaagaacaggatatattcagcattggggacaatttgtcattgttgaaccagaatatt
tcagatctcaaccagacgtccacgtctatcatcaccacttcagaaagctctgtgctgggt
aacctccctctgccagacctgttcccccagcaaatcaaacaggagagggtcttttccatg
gataaggacttgggaaattattgtggacaaacaggtgctggttctagcaatttggatggc
agcagtcagctaattgacgattcagagatttggcaagacctcgacctgtccagctcactg
ccagaaatcagtgattttgagttagattcagaggtggcacatctggataacatcctgcaa
gaaaacagcctcggtggrggttccatcattggcttgccgaaggaaaccaaacccctcctg
ggtaatggagaaaactgtaccagtgtgaatggcatggagcagcagcgtcgtcacccaatg
caacagcagcaacctccccaacacctggttcagcaccagcagcatgcgcttcagccccaa
cagtctccaaccatgatatctggtgttgtcatcaaggaggagaaggatccggatttcatc
cacttgagcactcctggtgtggtcaagctggagagacaagacagtgctggttactgccag
tcgcagtgtctccagggaggcatgggttctctccatggaggaggagcaggctccatgtca
tcccccatgggtgttggtgctggaccctcgtacagctacggagccagtcaaccgtccaca
gtgaacctgccagaccagaagccttttggcgccttctcaaccctgcctggggttggcgag
agctggctaggagggaaaagatacggagagtcrtctgggataccgagcggcagcgatggc
ctccagtcggcagcagctttggcaaattttcctgtcagcttctccagcacgtcaaccagg
accggagagcccagcagyactgtggtgtcaggccagtccaaacccggtgggcagggccaa
aaggtctgcttggtgtgctcggacgaggcctcaggatgccactacggggtggtgacctgc
ggcagctgcaaggtgttcttcaagagggctgttgaaggatggagagcacgacaaaacaca
gatggtcagcacaattacctgtgtgcaggaagaaacgattgcatcatcgataagatccgc
aggaagaactgtccggcatgccgcttcaggaaatgtcttcaagcaggaatgaatttggat
gcaaggaaaaacaagaagctacacaaagttagacctcagcggccccccgggccaccagag
ccygttaacttgcccattccagtcataccgaagaacctgccccagctggtgcccaccatg
ctgtccgttctaaaggccatcgaaccagagatcatctactcgggctacgacagcacgctg
ccggacacctcgtcacgcctcatgagcaccctcaacaggctagggggtcagcaggtcatc
tcggcagtcaagtgggccaagtcattgccaggtttccgtagcctccaccttgatgaccaa
atgacattgctgcagtgctcctggctgttcctcatgtccttcagtcttggttggaggtcc
tacgagcagtgcaacggcaagatgctctgctttgccccagatcttgtcataaacaaagag
cgcatgaatctgcctctaatggatgaccagtgcaagcagatgctgaagatctgcaacgag
ttcgtcagactgcaggtctcttatgaggagtatctgtgcatgaaggtgctcctactgctc
agcacagtaccaaaagagggcctgaagagccaggcgattttcgacgagatcaggatgacg
tacatcaaggagctgggaaaagccatcgtgaagagagaggagaacacgagccagaactgg
cagcgtttctaccagctaactaagctactggactccatgcaggagatggtcgagggtctc
ctgcaaatctgcttccacacctttgtgaataaaaccctgagtgtggaattcccagagatg
ctggcggagatcatcaccaaccagataccaaaattcaaagatgggagcgtcaagcctctg
ctttttcatcagaaatga

DBGET integrated database retrieval system