KEGG   Austrofundulus limnaeus (annual killifish): 106523725
Entry
106523725         CDS       T06063                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04137  Mitophagy - animal
alim04210  Apoptosis
alim04218  Cellular senescence
alim04620  Toll-like receptor signaling pathway
alim04621  NOD-like receptor signaling pathway
alim04622  RIG-I-like receptor signaling pathway
alim04623  Cytosolic DNA-sensing pathway
alim04625  C-type lectin receptor signaling pathway
alim04920  Adipocytokine signaling pathway
alim05132  Salmonella infection
alim05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106523725
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106523725
  09143 Cell growth and death
   04210 Apoptosis
    106523725
   04218 Cellular senescence
    106523725
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106523725
   04621 NOD-like receptor signaling pathway
    106523725
   04622 RIG-I-like receptor signaling pathway
    106523725
   04623 Cytosolic DNA-sensing pathway
    106523725
   04625 C-type lectin receptor signaling pathway
    106523725
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106523725
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106523725
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106523725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106523725
Transcription factors [BR:alim03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    106523725
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 106523725
NCBI-ProteinID: XP_013872707
UniProt: A0A2I4BY92
LinkDB
Position
Unknown
AA seq 629 aa
MDGVYGWGMNPLNPVQTASPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNAPYKPHPHELVGKDCKHGFYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPYNIPEAKVWEEEFDLNSVRLCFQASITLPAGELFPLEPVV
SQPIFDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRNTNLSEPIKVKMQLRRPSDREVSEPMDFQYLPADPDEYRLS
DKRKRTGDMFQNLKLGPMLSSVSISQRPMNVGRRMATPKTQPMTAQSVPEVPPXASSAPF
SFPQPGHLFSVQPKVEAPSSMATATATQTWKIMEGLKLSPQPKANPVPTFTMSSAPTPSS
STTTTTAAAHQDYSTVNLSDLHEFFPNIAQGAASSQAVAPQPSSSFTLQESQFRVDATLV
DEDIPEFPSFSDAQVPCTLDSLNMEDIEDLLNPCHMSEGGNATSGLQSCQQASVPKSAAV
AQPGAAAQSASEPPSNPGIAYMNYPNSIANLLRSEDMLVLGSGLTISNNNHHQSVVLDDF
DELMSADEDRLMSIFNGGGQAGFVSGHPT
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggatgggggatgaacccattaaacccagtccagacagcgagccct
tacatcgagatcatcgagcagccaaagcagagggggatgaggtttcggtataaatgcgag
ggacgttcagccggcagcattcctggagagaaaagcaacgacacaacaaagacttatcca
gccataaaggtgcacaactacagcggtcccctccgggtccgcatctcgttggtgacgaag
aacgccccgtacaaacctcacccccatgagctggtgggaaaagactgcaaacacgggttc
tacgaggccgacctgcaggagaggcggatacacagttttcagaacctggggatccagtgt
gtgaagaagaaggatgtgaatgaggccatcacttgcagactgcagaccaacaacaacccc
tacaatattcctgaggccaaggtgtgggaggaagagtttgacctgaactcggtgcggctt
tgcttccaggcctccatcaccttgcctgcgggggagctgtttcctctggagcccgtcgtg
tcccagcccatctttgacaacagagcaccaaacacagccgagttaaagatctgcagagtc
aaccgaaactccggcagctgcaaaggaggcgacgagattttcctgctgtgtgacaaagtg
cagaaagaggacatcgaggtgcgtttcttccaggactcctgggaggggaagggcacgttc
tcccaggcggacgtccacaggcaggtggccatcgttttccgtacgccaccgtaccgcaac
actaacctcagcgaacccattaaggtcaagatgcagctccggaggccctctgaccgagaa
gtcagtgaaccratggacttccagtacctccccgctgacccagatgagtataggctgagt
gacaagagaaagcgcacaggagacatgttccagaacctgaaactgggtccgatgctatca
agtgtgtccatttcacaacgacccatgaatgttggacgcagaatggccactcccaagact
cagccgatgactgcacaatcagtccctgaggttcccccagktgccagcagcgcccccttc
tcatttcctcagccaggacatctcttctcagttcagcctaaggtggaggccccctcctcc
atggccacagcaacggcaacccaaacctggaagatcatggagggtctaaagctgagcccc
cagcccaaagccaacccagtgcccacctttaccatgagctcagcaccgaccccgtcctcc
tccaccaccaccacaaccgccgcagcccaccaggactactccaccgtcaacctgtccgac
ctccacgagttcttccccaacatcgcccagggggctgcgtccagccaggcggtggccccg
cagcccagcagctccttcaccctccaggagtctcagttccgtgtcgatgcaacactcgtg
gatgaggacatcccagagttccccagcttctctgacgcccaggtaccctgcaccctggac
agcctgaacatggaagacatagaggacctcctgaacccgtgccacatgagcgagggcgga
aacgctacttcgggcttacagtcgtgccagcaagcgtccgtccctaagtccgccgccgtg
gctcagcctggtgccgcggcccaaagtgcatctgagccacccagtaatcccggaatcgcc
tacatgaattaccccaacagcatcgctaacctgctccgcagcgaagacatgctggtcctg
ggctcaggcctcaccatcagcaacaacaaccaccaccagtctgtggtgctcgacgacttc
gatgagctgatgtccgccgacgaggaccgcctcatgtccatttttaacggtggaggtcaa
gctgggtttgtgtcaggacatccaacctaa

DBGET integrated database retrieval system