KEGG   Austrofundulus limnaeus (annual killifish): 106524000
Entry
106524000         CDS       T06063                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106524000 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106524000 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106524000 (kitlg)
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106524000 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106524000
NCBI-ProteinID: XP_013873070
UniProt: A0A2I4BZ99
LinkDB
Position
Unknown
AA seq 211 aa
MKKSKSWIHVCVRFLLFITLGVHSATFEVTAVTDGCHDLPSNLKQNIPKDYKIPVFYIPK
EVARMCWVKLNIYYLEQSIQDLADKFGNVSSNKQDINLVNHCLQNVRMIINDLNREMLDF
ECHYRREWWETEQYFNFVEELFGAANSEDFSYECDPPPCPSTPAPDSLSTESPTPSEPPV
HNGHSSQTINQCDSSTCKFAIFYLKCIREKN
NT seq 634 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacgtttgtgtccgtttcctgctgttcatcacactt
ggggtacattcagctacattcgaagttaccgccgtgactgatggctgtcacgatttacct
tctaatttgaaacaaaatattccaaaagattataaaattcctgtattttacattccgaaa
gaagtggctagaatgtgttgggtgaaattaaatatttactacttggagcagagtatacaa
gatttagccgataagtttggaaatgtttcatccaataaacaggacatcaatttagtcaac
cattgtcttcagaatgtgcgaatgatcatcaatgacttaaatcgggaaatgttggatttt
gaatgccactacagacgagagtggtgggaaacagagcaatactttaattttgtcgaagaa
ctcttcggagctgcaaattctgaagacttttcatatgagtgtgatcctcctccctgtccc
agtacaccagccccggactccctttccactgagtcaccgactccctcggagccacctgtt
cacaacggtcacagctctcaaacaatcaaccagtgtgacagctcaacatgtaagtttgca
attttctatttaaagtgcatcagagaaaaaaatc

DBGET integrated database retrieval system