KEGG   Austrofundulus limnaeus (annual killifish): 106524096
Entry
106524096         CDS       T06063                                 

Gene name
pdgfra
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04020  Calcium signaling pathway
alim04144  Endocytosis
alim04510  Focal adhesion
alim04540  Gap junction
alim04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106524096 (pdgfra)
   04020 Calcium signaling pathway
    106524096 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106524096 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106524096 (pdgfra)
   04540 Gap junction
    106524096 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106524096 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:alim01001]
    106524096 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:alim04090]
    106524096 (pdgfra)
Enzymes [BR:alim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106524096 (pdgfra)
Protein kinases [BR:alim01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106524096 (pdgfra)
CD molecules [BR:alim04090]
 Proteins
  106524096 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Izumo-Ig Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 106524096
NCBI-ProteinID: XP_013873208
UniProt: A0A2I4BZN3
LinkDB
Position
Unknown
AA seq 1379 aa
MYANKEAEQHHGGMLDDVAFIYIFVQDPDVLFVPETPENLIVPYNTFRVIVPCRVSHPTL
PVVLRSMSSGEKISDFYVDKTGFIERISPGQYQCETTVKGRTFTSAIYTVKDEEPEELED
FEVEVKASEETVRAGQPLNISCITPAGADYFQYWLHPKTQAPNALQTKQTSPDWVIYTLS
IPQASSQDSGTYQCSITHAASGKTRVSSVAVTVFEENSFLTLDHSGILTTEFVSIFEATE
FTILINAYPVPKVSWLKDGKELSENYYIFTKTSHTEGNRYESVLMFRHPLEKDNGNYTIT
VVCGSHRTQFSFSIKVRVSAGVMIPPSSAPVLLPDVDEMVVPLHTSFSLTCRGVARLGWD
MPFDMPEQTQEDSSGLFVTTITVDSATVTHTGYYTCFYSANSTGDTEESSIYIYVPDPNT
PFVPSLGHYLNHVLTDXEEMEIPCRVSNPQAHVTLVNVDTQQPVPSVYDSKRGALGIFTA
GTYVCKAVIQGEEHFSSEYIVHGVIGALNVELSAKKSTLLVGDTITVNCLARGSDILEDH
WKYPGKLVNRGSKTVRENKRDQEILYTLTIPQATTKDSGTYSCSITDIISNESRTKQLAI
QVFASKFVSIQPEFGDYESTELDDVREFRAKIDSFPDAHVTWLKDGVPLGDVTAEISTSL
QQISDISYMSILTLIRAKKEDSGNYTIHVQNGNQSRDVSFILEVKEPAVIVDLMDLHHGS
TSGQSVVCITRGQPTPVVEWFICSNIKHCANDSSSWLPLPINSTEITTESHFDDESNLES
QVMFGHLKSTLAVRCLARNEMAAVSREIKLVSNGPHPELTVAAAVLVLLVIVIISLIVLV
VIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGK
VVEGTTYGLSRSQPVMQVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTK
SGPIYIITEYCFYGDLVNYLHKNRENFHSLSPEKSKKDLDIFGINPADESSRSYVILSFE
RKGDYMDMKQADNTQYVPMLEMCSSSKYSDIRRSNYDHPPSQKDSNESEIDTLLSDDMNE
GLTTVDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNN
YVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNK
IKSGYRMSKPEHAPPDVYEMMMKCWNSEPEKRPSFLGLSETVESLLPSSYKRHYERVNHD
FLKSDHPAVIRVGVETDADYVDIPYKNQAKLKDRESSFDEQRLSSDSGYIIPLPDLEPIS
DEDYGKRNRHSSQTSEESAIETGSSSSTYXKREGETLEDITLLDEMCLDCSDLAEDSFL
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgtacgcaaacaaggaggctgagcagcatcacggtggaatgctcgatgatgtggctttt
atttacatctttgtccaagatcctgatgtcctgtttgtcccagagacaccagaaaacctc
atcgttccttacaacacgttccgagtgattgtcccgtgtcgggtgtcccacccaacgctt
cctgtcgtcctgaggagcatgtccagcggggagaagatcagtgacttttatgttgacaag
acaggctttattgaaaggatctctcctgggcagtaccagtgtgagaccactgtgaagggc
cggaccttcaccagtgccatctacactgtaaaagatgaggaacctgaggagctggaggat
tttgaggtggaagttaaagccagtgaagagacggtgagggccgggcagcctctcaacatc
tcctgcatcaccccagctggagccgattactttcagtactggcttcatccaaaaacacag
gctccaaatgcgcttcagaccaagcagacttctcctgactgggtcatttacactctcagt
atcccacaagccagctctcaggacagcggcacctaccagtgctccatcacacacgcagcc
agtggaaaaacccgagtcagcagcgtggctgtaactgtgtttgaggagaattcattcctg
accctggaccacagtgggattcttacaactgagtttgttagcattttcgaggcgacagaa
tttaccattctcatcaacgcttaccccgtccccaaagtgtcatggctgaaagatggcaaa
gaactgtcagagaactattacatcttcaccaaaacaagccacactgaaggcaatcggtat
gaaagcgttctgatgttccgccatcctctggagaaagacaatggaaattacaccattaca
gtcgtgtgtggctctcacagaacccagttctctttttccattaaagtgagagtttctgct
ggagtgatgatccctccttcctcggcccccgtgttgctgccggatgtggatgagatggtg
gtgcctcttcacacgtcgttcagcttgacgtgtcgaggagtggctcggctgggatgggat
atgccatttgatatgcctgagcaaactcaagaggatagcagcggtctgtttgtcaccacc
atcaccgtcgacagtgcaacagtaacgcacactggctactatacatgcttctacagcgca
aacagcacaggcgacacagaggaaagcagcatctacatctatgtaccagatcccaatact
ccttttgtgccatcactggggcattatctaaaccatgtcctgactgactargaggagatg
gagataccatgtagggtgtctaacccccaagctcacgtgacgctcgtgaatgttgacaca
cagcagcctgtgccaagtgtttacgacagtaaaagaggtgctttggggatctttaccgca
ggaacatatgtttgtaaggctgtcatacaaggagaagagcacttcagcagtgaatacatc
gtacatggtgtgataggtgccttgaatgttgagctgtcagccaaaaagtccacactactg
gtgggagacactattactgtcaactgtctagctcgaggatctgacatattggaggaccac
tggaaataccctggaaagctggtcaaccgtggcagcaaaactgtccgtgaaaataagaga
gaccaagagatcctgtataccctaacaattcctcaagccacaaccaaagacagtggaacc
tactcctgttccattacggacattatttctaatgaaagtcggacaaagcaacttgccatc
caagtgtttgcgagtaaatttgtgtccatccagccggagttcggggattatgaatctact
gagctggatgatgtccgggagttcagagcaaagatcgactcctttcccgatgctcatgtc
acttggctcaaagatggcgttcctctcggtgatgtaactgctgagatctccaccagcctg
cagcagatcagtgacatcagctacatgagcattctcacattaattcgtgccaagaaggag
gacagtggaaactacaccattcatgtgcagaatggaaaccagagtcgtgatgtcagcttc
atcctggaggttaaagagcctgcagtcattgtagatttaatggatcttcaccacggttca
acctcaggccagtctgtggtgtgcatcaccagggggcagcccactcctgtggtggagtgg
tttatctgcagtaacatcaaacactgtgccaatgattcgtcttcctggctgccccttccg
atcaactccacagagatcaccacggagtcgcactttgatgacgagagcaacctggagagc
caggtcatgtttggtcatctgaaaagcacgctggcggtacgttgccttgccaggaatgaa
atggctgccgttagcagggaaatcaagctggtgtccaacggccctcaccctgagctgact
gtagctgctgctgtgctggtgctcctggtcattgtcatcatctcactcattgtcttggtt
gtcatctggaaacagaaaccaagatatgagatccggtggagggtcatagagtctgtaagc
ccagatggccatgagtacatctatgtggatcccatgcaacttccgtatgactccagatgg
gagtttccccgggacagacttgtgcttggtcgtatcctgggctctggagcttttgggaaa
gtggtggagggcaccacttatggactcagccgctctcagcctgttatgcaggtggcagtg
aaaatgttgaaacccacggctcggtccagtgagaaacaagccctgatgtctgaactcaag
atcatgactcatctcggaccccatctcaacatcgttaacctcctgggagcgtgcaccaag
tcaggccctatctacattatcaccgagtactgcttctacggagacctggtcaactatctg
cacaagaacagggagaacttccacagcctgagcccagagaaaagcaaaaaggatctggat
atctttggtatcaaccctgcagatgagagcagcaggagctacgtgatcctgtcctttgag
aggaaaggagactacatggatatgaagcaggcggacaacactcagtatgtccccatgctg
gagatgtgcagctcctccaagtattctgacatcaggaggtcgaactacgaccaccctccc
tcacagaaagactccaacgagtccgagatcgacaccctgctgtcagacgacatgaacgaa
ggcctcacaaccgtcgacctgctgagctttacctatcaggtggccagaggaatggagttt
cttgcctccaaaaattgtgtgcaccgcgaccttgcagccaggaatgttcttctttctcag
ggcaaaattgttaaaatctgtgactttggactggccagagacatcatgcatgataacaac
tatgtctccaaaggaagcacatttttgccagtaaagtggatggcaccagaaagcattttc
gacaacctctacacgactctcagtgatgtttggtcttatggtatcctcctctgggaaatt
ttttccttaggtggtacaccgtatccagggatggtggttgactccagcttctacaacaag
atcaagagtggatacaggatgtccaaaccagagcacgcaccacctgatgtgtatgagatg
atgatgaagtgctggaacagtgagccagagaagaggccttccttcttgggtctgagtgaa
actgtggagtctttgctgccctccagttataagagacattatgagagagtcaaccatgac
ttcctgaaaagtgaccatcccgctgtgattcgagtgggcgtggaaaccgatgcagattat
gttgacatcccatacaagaaccaggcaaagctaaaagaccgggaaagcagctttgatgag
cagcgactgagctctgacagtggctacattatcccacttccagacctcgaaccaatctca
gatgaagactatggaaagcggaacagacacagctctcaaacgtctgaggagagcgccatt
gagacgggctccagcagctccacctatgrtaaacgtgagggggagactttggaggacatc
acactgctggatgagatgtgtctggactgtagtgacctggcggaggacagctttctgtga

DBGET integrated database retrieval system