KEGG   Austrofundulus limnaeus (annual killifish): 106525565
Entry
106525565         CDS       T06063                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04012  ErbB signaling pathway
alim04068  FoxO signaling pathway
alim04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106525565
   04068 FoxO signaling pathway
    106525565
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106525565
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106525565
NCBI-ProteinID: XP_013875310
UniProt: A0A2I4C5Q1
LinkDB
Position
Unknown
AA seq 180 aa
MSDVRLSNASPTVERVDARQPAESVRSGARRMLFGKPDREEIRRYADASQRESVRDFRER
FNFDPVTETPLPGGDYEWKADEEAPEFYSRLPHGSERPPRGEARDSPGRGEESRTRTESA
PETKGSRKRRSGASGSCSDECPKRRSKSDRDDDDDEEEEEDCVGGVVKTSSRPEDNQEVL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgcctttccaacgcgagcccgacggtggagagggtggacgcccggcag
cccgccgagagcgtccgctcgggcgcccgccggatgctgttcggcaagcccgaccgggag
gagattcggaggtacgcggacgcctcgcagcgggagagcgtgcgggatttcagggagcgg
tttaacttcgacccggtgacggagacgccgctccccgggggggactacgaatggaaggcg
gacgaggaggcaccggagttttacagcaggctgccccacgggagtgaacggccgccgcgg
ggagaggctcgagactcgcccggccgcggcgaggagagcaggacgaggaccgagtccgct
ccagagacgaagggttcgaggaaacgacgatcgggagcctccggttcctgctccgatgag
tgtccgaagagaaggtcgaagtcggacagggatgatgatgatgatgaggaggaggaggag
gactgtgttggaggtgtggtgaagacatccagcaggcctgaggataaccaggaggtcctg
taa

DBGET integrated database retrieval system