KEGG   Austrofundulus limnaeus (annual killifish): 106528099
Entry
106528099         CDS       T06063                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04068  FoxO signaling pathway
alim04217  Necroptosis
alim04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106528099 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106528099 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106528099 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106528099 (stat3)
Transcription factors [BR:alim03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106528099 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AP1AR
Other DBs
NCBI-GeneID: 106528099
NCBI-ProteinID: XP_013878632
UniProt: A0A2I4CF65
LinkDB
Position
Unknown
AA seq 786 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQNAT
TASQNGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKETGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKVDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPSVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDIGGKTQIQSVEPYTKQQLSNMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEDAFGKYCRPDAAHEPEPGGDSMITQPYLKTKFICVTPCP
SVFMDLPDSELLGNGFPGTNSGNTSDLFLMSPRTLDSLDSLIPGEAETSQGHLDSITVNM
DVASPM
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagttgcagcagctggaaaccaggtacctggagcaactctaccac
ctgtacagtgacagcttccctatggagctacggcagttcctggccccatggatcgaaagt
caggactgggcctacgctgccaacaaggaatcccacgctacattggtgttccacaacctt
ttgggagaaatagaccagcagtacagccgcttcctgcaggagaacaatgtgctctaccag
cataacctgcgcaggattaagcagcatctgcagagcaaatatctggagaagccgatggaa
atcgctcgcattgttgcccgttgtctgtgggaggagcagaggctgttgcagaatgccacc
actgcttcacagaacggccaggcagcccatcccactggaactgtagtgacagagaaacag
caaatactggagcacaaccttcaggacatcaggaagcgggttcaggatatggaacagaag
atgaaaatgctcgagaacttgcaagacgattttgacttcaattacaaaaccctgaaaagc
caaggggagctgtcgcaggatctgaacgggaatagccaggctgctgccacaagacagaag
atggctcagctggagcaaatgttgagcgctctggaccagctcaggaggcaaattgtgacg
gagatggggggcctgctgactgccatggattatgttcagaagaatctgacagatgaagag
ctagcagactggaagagaagacagcagatcgcctgcatcggaggcccaccaaatatctgc
ctggatcgccttgaaacatggatcacatccttggccgagtcccagcttcagatccgtcaa
cagatcaagaagctggaggagcttcagcagaaggtgtcttacaaaggagaccccatcatt
cagcatcggcccgccctggaggagaagattgtggacttgttcagaaacctgatgaagagt
gcctttgtggttgaaagacagccgtgtatgcccatgcatccagacagacctctggtgata
aaaacaggagtgcagttcacaactaaagtccggttactggtaaagtttcctgaactcaac
taccagctgaaaattaaagtctgcattgacaaagaaactggggatgtagctgcaattaga
ggatcacgaaagtttaacatcctcggaacgaacacaaaagtcatgaacatggaggagtct
aacaacgggagcctttctgcagagttcaaacacttgaccttaagggaacaaagatgtggc
aatggtggtcgcactaatagtgatgcctctctgattgtaacagaggagcttcacctcatc
acatttgagacagaagtctatcaccaaggcctgaaagtagatctggagactcattcgctg
cctgtggtagtcatttcaaacatctgccagatgcccaacgcctgggcctccatcctgtgg
tacaacatgctcaccaatcacccaaagaacgtgaacttcttcactaagcctcctgtgggg
acctgggaccaggtggccgaggtgctgagctggcagttctcctcaaccacaaagagaggc
ctgaccatcgagcagctgaccactctggctgagaaactacttgggccctctgtcaactac
tccggatgccaaataacatgggccaagttctgtaaggaaaacatggctggcaaaggcttc
tccttctgggtgtggctggacaacatcatcgacctggtgaagaaatatatcctcgcgctg
tggaacgaagggtacatcatgggttttatcagcaaggagagggaaagagccattctgagt
cccaaacctcctggcactttcctgctgcgcttcagcgagagcagcaaggaggggggtatt
acattcacctgggtagaaaaagatatcggcggaaagactcagatacagtcagtggagccg
tacaccaagcaacagctcagcaacatgtcctttgctgacatcatcatgggctacaagatc
atggatgccaccaacattctggtttcacctctggtttatctgtatcccgatattcccaaa
gaggatgcttttgggaaatattgtaggccagatgcagctcatgaacctgagccaggtggt
gactccatgattacccagccgtatttgaagacaaagttcatctgtgttaccccgtgtccc
tccgtgttcatggacttgccagacagtgagctgcttgggaacggattccctggcaccaac
tctggaaacaccagtgacctgttcctcatgtcgccgcgcaccctggactctctggactct
ctgattcccggtgaagctgaaaccagccaaggacatctggattcgatcactgtaaacatg
gatgttgcgtctcctatgtga

DBGET integrated database retrieval system