KEGG   Austrofundulus limnaeus (annual killifish): 106528703
Entry
106528703         CDS       T06063                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04141  Protein processing in endoplasmic reticulum
alim04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:alim00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106528703 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106528703 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106528703 (atf6b)
Transcription factors [BR:alim03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106528703 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU HAUS6_N CENP-H
Other DBs
NCBI-GeneID: 106528703
NCBI-ProteinID: XP_013879396
UniProt: A0A2I4CHC8
LinkDB
Position
Unknown
AA seq 711 aa
MATDLLSDLDTRFFADNLLTSEDWDACLYQCESMEEGEDGDLSQRLSYDASFDNDLVLTL
DPDNRTSPWQHLDNNLLTGNTSVIKNEMTITEPLPVEMLFQIKAEPPSPASSLESDYSVS
SPEPQVTVKGENPPTPPYLYGDVLSPPLGTMEVTVATTTVPPPQTQIPTVTQTSLTSVPA
VISGIQTQAAVLPSTTTLKASTILSNKPPIQPRPVCVATLPVPQNPTPAKTLILQSLPSM
DQTRPVVLSPSVCLSSAPAIVKMEPVSPSIPQHCSSPTSSSSSSSSSKPIVPATTPLPGN
NSSDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRE
RLAGKESSDSVSNKRAVCVMAVLLFMTFSFGPVSITDRKLPTDLQEDVMSFPGRQLLEIK
PEQQAAAQPPSKVEDKTEAEEDGGDERWRRGEAERYDPETFQFRNLSAMFSDMKDLALQD
IDRYFSSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIAKKAKITQKAQLRKT
NFSRYLPIQAHGSIESHLKVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHN
KTSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVAIKSSAVPPSLRDPTPP
PPSSQHGPHHHHSNNTSLRGRHQHHPSPSSRQPLPARRQTPEYLISQSGGV
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggctacagatttactttctgatttggacacccgattctttgccgataaccttctgacg
agcgaagactgggatgcctgcctgtaccagtgtgagagcatggaggagggggaggacgga
gacttaagtcagaggctgagctacgatgcgtcgttcgacaacgacctcgtgctcaccctc
gatcccgacaaccgcacgtcgccatggcaacacctcgacaacaacctcctgacaggaaac
acttcagtgataaaaaacgagatgaccataacagaacctttaccagtggaaatgttgttc
cagataaaagcagagcctccgtctcctgcgtcctctctggagtccgactattccgtgtcc
tcacccgaaccacaggttacagtkaaaggtgaaaaccctccgactcctccgtacttgtac
ggagacgtgctgtctcctccgctggggacgatggaggtgacggtggccacgacgacagtg
cccccgcctcagacccagatacctacagtgacacagacttcgctaacgtccgtcccggcc
gtcatcagtggaatccagacgcaagctgcagtccttccgagcacaacaacattaaaagcc
agcaccatcctcagcaacaaacctcccatccagccccgaccggtgtgcgtcgccaccctc
ccagtcccccagaaccccacacctgccaagaccctcatactgcagagcctcccctccatg
gaccagaccagacctgtcgtcctctctccgtccgtctgcctcagttcggctcctgctatc
gtcaaaatggagcccgtctctcccagcatcccccagcactgctccagcccaacctcctcc
tcctcctcctcctccagcagcaaacccatcgtccccgcgaccacgccgttaccgggaaac
aactccagcgacatcgatatgaaggtgctgaagaggcagcagaggatgataaagaacaga
gagtcggcctgccagtccagaaagaaaaagaaggagtatctgcagaacctggaggcccag
ctgagggaggcccagcaggagaacgagcggctccggagggagaaccaggcactgagggag
agactggctgggaaagagagcagcgaytctgtgagcaacaagagagccgtgtgcgtcatg
gccgtgctgctgttcatgaccttcagcttcggacctgtcagcatcacagacaggaagctg
cccacagacctgcaggaagacgtgatgtcatttccgggacggcagctgctcgagatcaaa
ccggagcagcaggcagcagctcagccccccagcaaagtggaggacaagacggaggcagag
gaggacgggggagacgagcgatggaggagaggcgaggccgagagatacgaccccgagact
tttcagttccgaaacctgagtgccatgttcagtgacatgaaggacttggccctgcaggac
atcgaccgttatttctcctcctctgattgccgacagttcaaccgctctgagtccctcagg
ctggcagatgagctgagaggttgggttcatcgacatcagatcgacaggaagaagtctgga
ggaaaaccaaaaatcgccaagaaggcaaagatcacccagaaagctcagctgaggaagacc
aacttctccagatatctgccaatccaggctcacggttccatagaaagtcatctgaaagta
cttcctggtccagaggtcacctacagcgacttcctggacgccattgatcgcagagaggac
accttctatgtcgtctctttcaggcgggaccacctgctgcttcctgccatcagccacaac
aaaaccagccggcccaagatgtctctggtgatgcccgccatgtccgtcaacgagagtctg
tacaactcgtctcagggctacgagatgatgatgcaggtcgactgcgaggtcatggacacc
cgaatcgttgccatcaagtcgtccgccgtgcccccgtccctccgcgaccccaccccgcct
ccgccctcctcccagcacggcccccaccatcaccacagcaacaacacgtccctccggggg
cgccaccagcatcacccctcgcctagttcgcggcaacccctgccagcccgcagacagacg
cccgaatacttgatcagtcagtcgggcggggtctaa

DBGET integrated database retrieval system