KEGG   Austrofundulus limnaeus (annual killifish): 106529464
Entry
106529464         CDS       T06063                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04080  Neuroactive ligand-receptor interaction
alim04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106529464 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106529464 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:alim04030]
    106529464 (lpar2)
G protein-coupled receptors [BR:alim04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    106529464 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 106529464
NCBI-ProteinID: XP_013880362
UniProt: A0A2I4CK47
LinkDB
Position
Unknown
AA seq 360 aa
MASENNAWNTCDSNHNVTFFYNLVGKELREKWTVRDFFVIGLGLTVCVIVVLANLLVIVA
IFKNRRFHFPIYYLLGNMAAADLFAGLAYANLMLNTGPWTARLTKEQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSNMTKRRVVLLIVCIWATGIIMGLVPSVFWNCECDHD
DCSTVAPLYSRRFLIFWAVLNLLTFFIMVAMYARIFYYVKGQSRSMSEHTSEMHHNQTVV
NLMKTISMVLGAFVICWTPGLITLLMDGLLGKEGQADKYEKYCLVIAECNSLVNPIIYSL
RDNEMRRTFKWILCCLCRRGVNRQQVSSPIEIDSPLKEKTFDSFQKFEDQTLWKLQDTDD
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcctctgaaaacaacgcgtggaacacctgcgactccaaccacaacgtcaccttcttc
tacaacttggtgggcaaggagctgagagaaaagtggaccgtgcgggacttttttgtcatc
ggactgggcttgacggtgtgtgttattgtagtcctggccaacttgttggtgattgtagcc
attttcaagaaccgccgcttccatttccccatctattacctgctgggcaacatggctgca
gcagacctgtttgcaggtctcgcctacgctaacctgatgttgaacacgggtccctggact
gcaaggctaactaaggagcagtggtacatccgaggggctttaattgacatcagcctaact
gcctctgtagccaacctgctggccgttgccgtggagcgccaccagaccatcataaccatg
cagctgcacagcaacatgaccaagcggcgggtggtgctgctcatcgtttgcatctgggcc
actggaatcatcatgggtytggttccctcggtcttttggaactgtgaatgtgaccacgac
gactgctccaccgttgcgcccctctacagccgccgctttctgattttctgggcagtcctc
aacctgctcactttcttcatcatggtggccatgtacgctcgcatcttctactacgtgaag
ggccagagtcggtccatgtccgagcacacctcggagatgcaccacaaccaaacggtggtc
aacctgatgaaaaccatctccatggttctgggggcctttgtaatctgctggacccccggc
ctcattaccctcctaatggacggtctgttgggtaaagagggccaggccgacaaatacgag
aagtactgcttggtgatagcagagtgtaactctctggtcaatcccatcatttattccctg
cgggacaacgagatgcggaggacgttcaagtggatcctgtgctgtctgtgtcgaagaggc
gttaatcgacagcaagtgtcttcgcccatcgagatcgactccccgctgaaggagaaaacc
tttgacagtttccagaagtttgaagatcagactttgtggaagcttcaggacacagatgat
tga

DBGET integrated database retrieval system