KEGG   Austrofundulus limnaeus (annual killifish): 106530667
Entry
106530667         CDS       T06063                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim00230  Purine metabolism
alim01100  Metabolic pathways
alim04020  Calcium signaling pathway
alim04114  Oocyte meiosis
alim04261  Adrenergic signaling in cardiomyocytes
alim04270  Vascular smooth muscle contraction
alim04371  Apelin signaling pathway
alim04540  Gap junction
alim04912  GnRH signaling pathway
alim04914  Progesterone-mediated oocyte maturation
alim04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:alim00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106530667
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106530667
   04020 Calcium signaling pathway
    106530667
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106530667
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106530667
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106530667
   04914 Progesterone-mediated oocyte maturation
    106530667
   04916 Melanogenesis
    106530667
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106530667
   04270 Vascular smooth muscle contraction
    106530667
Enzymes [BR:alim01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106530667
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4
Other DBs
NCBI-GeneID: 106530667
NCBI-ProteinID: XP_013881793
UniProt: A0A2I4CP73
LinkDB
Position
Unknown
AA seq 1123 aa
MPRNQAFSEPEFSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYVLITCAVVYTSDRLASVLVASVGLTGDII
LYLLCRFGLLPDRITRRVVPYALWVLIAVQIFCYLGLNFARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLVTAVSCAVHTLVLGVTIAQQQQQQQQDIEGAALTRQLLANLVIYICTI
TVGVMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLKDMKK
EPSQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAK
YHQLRIKILGDCYYCICGLPIYREDHAACSIMMGLAMVEAISYVREKTQTNVDMRVGVHS
GTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDMEPGNGGD
RCDYLRERGIETYLVIVPKGAVGKNGISGVKLSVTSSNGNSPLLINTTECNGSVNTACXT
PEEPEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALK
GKRTNKLSLRFVDPDMETLFSKEKEKQSGAAFCCSCVVLLFTAVMEALIDPRLIANYITF
AVGEVLLLILTICSMAAIFPRVFPKKLVSFSMWIDHTRWARNTWAMAAIFILTMADLIDM
LSCLPGVPESNGPTQAPSSSSRSSLEGCLNNPKYYSYIAVLALMATTMLVQVSHMVKLTL
MLLITVTTGIVNIYSWRDIFDRYDKARFQDYSVFMVPSKFTMTCMIFVMMVSFYYFSRHV
EKLARTLFLWKIEVHEQKEKVNEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYD
EIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGST
YMAASGVTPDINNDYTCMKQKQEQSDKERWQHLADLADFALAMKVTLMNINYQSFNNFML
RIGLNKGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYNFRF
VRRGPIFVKGKGELLTYFLKGRDKHGSFINGSSVTLPHQVVDS
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgccacggaaccaagctttttcagaaccggagttttctgcggagtattctgcggactgc
tcggtgacgttgccctctgacccgggccaggctgtggggcggacacacgaggtgacggtg
aggagctcggggtgctgcctgtgcctgccgcgcttcatgcgcctcacctttgcaccggag
tctttagagaacctgtaccagacctacttcaggcggcagagacacgaaaccctgctggtt
ctggtcgtgttcgcggccctgttcgacagctatgtcctcatcacctgcgcggtggtctac
acctccgacaggctggcctctgttttagtggcgtcagtgggactcacgggcgacattatt
ctctacctgctgtgccgcttcgggctgcttccggaccggatcacgcggcgggtggtgccc
tacgccctctgggtgctcatagcggtccagattttctgctacttaggtctgaacttcgct
cgcttccaccaggccagcgacacggtgggctggcaggcgtttttcagcttttctttcttt
ctcacgctgcctttgagactcacacccattgtgctcgtcacggccgtgtcctgtgcggtc
cacactctggttctgggggtcaccattgcacaacagcaacagcagcagcagcaggacatc
gagggggcggcgctcacccgacagctgttggccaaccttgtgatctacatatgtaccatc
actgtgggtgtcatgtcctactacatggctgaccgaaagcatcgaaaggcttttctggag
gcaagacagtcactggaggttaaacttaacctggaagagcagagccagcaacaggagcgt
cttctgctctccattcttcccaaacacattgcagatgagatgctgaaggacatgaagaag
gagcccagtcagaaggagatgcagcagttcaacactatgtacatgtacaggcatgaaaat
gtcagtattttgtttgcagacattgtgggcttcacccagctgtcgtcgtcctgcagcgct
caggaactggtcaaactgctcaatgagctgttcgctcgctttgacaagctggctgctaaa
tatcaccagctgaggatcaagatcttgggagactgctactattgtatctgtggtcttccg
atctacagagaggaccatgctgcctgctccattatgatgggcctggccatggtggaagcc
atctcgtacgttcgagagaaaacccagactaatgtggacatgagagtgggcgtgcacagt
ggtacggtcctgggtggagttctgggccagaaaagatggcagtatgatgtctggtccaca
gacgtcactgtggccaacaaaatggaagctggaggtattcctggtcgggtccacatctcg
cagagtaccatggagtgtcttcacggagagttcgacatggaaccagggaacggcggagac
cgctgtgactacctgagagagaggggcatcgagacctacctggtgattgttcctaaagga
gctgtgggaaagaatggcatcagtggtgtgaagctgtctgtcacctcctctaatggaaac
tctccacttttaatcaacacgacggagtgtaacggcagtgtgaacacagcctgcarcaca
ccggaggagccggaggagctggacaccagggtggtgaatccgtccttcccgaaccctcgg
agaaggctgcggctgcgcgatctggccgagagggtgatcgatgctcaggagaatgagcag
gagctcaacaagctgctgaacgaggctctgctggaaagagaaaccgttcaggctctgaaa
gggaaacggaccaacaagctgtccctgaggtttgtggatccagacatggagaccctgttc
tccaaagagaaggagaaacagagcggagctgcgttctgctgctcctgtgtggttctgctc
ttcaccgcagtgatggaagctctcatagatccacggctgattgcaaactacatcactttt
gcggtcggagaggttctgctgctcatcctgaccatctgctctatggctgccatctttccc
agagttttccccaagaagctggtttctttctcaatgtggatcgaccacactcgttgggct
cggaacacctgggccatggcagccattttcatcctgaccatggcagacctcatagacatg
ctgagttgtctgcctggagtcccygagtcaaacggccccacacaggctccctcctcttcc
tcgcggtccagcctcgaaggttgcctgaacaaccccaagtattacagctacatagcggtg
ttagccctcatggccaccaccatgctggttcaagtcagtcacatggtgaagctcacgctg
atgctcctcatcacggtgacgaccggtatcgtcaacatctacagctggagggacatcttc
gaccgctacgacaaggcccgcttccaagattacagcgtgttcatggttccttccaagttc
acaatgacatgtatgatcttcgttatgatggtcagcttctattatttctccagacatgtg
gagaaacttgctcgaacccttttcctatggaagattgaggtccatgagcagaaggagaag
gtaaatgagatgcggcgctggaacgaagctctggtgaccaacatgttgcctgaacacgtg
gctcgacactttctgggctccaagaaaagagacgaggagctgtacagccagtcctacgat
gagattggagtcatgtttgcctcgattcccaacttctccgacttttacactgaagagagc
atcaataacggcggcatcgagtgtttacgctttctgaacgagatcatctcagactttgac
agcctcctggatgagcctcagtttcgctgcatcaccaagatcaagaccatcggcagcacc
tacatggctgcgtcaggtgtgactccagacatcaacaacgactacacctgtatgaagcag
aagcaggagcagtctgacaaagagcgttggcagcacctggcagacctggcagattttgct
ctggcgatgaaggtcaccctcatgaacataaactaccagtcattcaacaacttcatgctg
cgcataggtctgaataaagggggggtgttagcaggagtcatcggcgcacggaaacctcac
tttgacatctggggcaacactgtgaatgtagccagtcggatggagtccacaggtgtgatg
ggaaacatccaggtggtggaggactgctacaacatcttgaaggagtacaacttccgcttt
gtgaggcgggggcccatctttgtgaagggyaaaggagagctcctcacttattttctcaaa
ggaagagacaaacatggctcctttattaacggctcctcggtcactctgccacaccaggtg
gtggacagttaa

DBGET integrated database retrieval system