KEGG   Austrofundulus limnaeus (annual killifish): 106532371
Entry
106532371         CDS       T06063                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106532371 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106532371 (epo)
Cytokines and growth factors [BR:alim04052]
 Cytokines
  CSF and other factors
   106532371 (epo)
SSDB
Motif
Pfam: EPO_TPO RE_TaqI
Other DBs
NCBI-GeneID: 106532371
NCBI-ProteinID: XP_013883866
UniProt: A0A2I4CV49
LinkDB
Position
Unknown
AA seq 185 aa
MLRKTCKGLFALLLIVLEWTRPGLLSPLRPICDLRVLNHFIQEARDAETAMKSCREGCSL
SASVSVPQTTVNFDDWEKKTAQEQAQEVQTGLWLLQQALSLLQTSMTNAELNVHIDNTVR
NLLSINAVLRSLNIQEYTPPASAAGLPGTWRVSSAAELLQVHVNFLRGKVRLLLLDAQAC
RQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcggaaaacttgtaaaggactgtttgccttgctgttgatagtgttggagtggacg
cgtccaggcctgctatccccactgaggccgatctgtgacctgagggtcctgaaccatttc
atccaggaagcacgagacgcagaaactgctatgaagtcgtgtagagaaggatgcagcctg
tcagcatctgtctctgttccccaaaccactgtcaactttgatgactgggagaagaaaact
gcgcaggagcaagctcaggaagttcagacgggcttgtggcttttacaacaggccctcagc
ttactacagacgtcgatgacaaatgcagagctgaacgtccacatagacaacactgtcaga
aacctgctcagcatcaacgctgtgctgcgaagtctcaatattcaggaatatactccacca
gccagtgcagcgggactcccgggaacgtggcgggtgtcctcggcagcagagctgctccaa
gttcacgtaaacttcctgcgagggaaagtgcgcctgctgctcttggacgcgcaggcttgt
cggcaagacgtcagctga

DBGET integrated database retrieval system