KEGG   Austrofundulus limnaeus (annual killifish): 106534412
Entry
106534412         CDS       T06063                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106534412
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alim03000]
    106534412
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:alim03310]
    106534412
Transcription factors [BR:alim03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    106534412
Nuclear receptors [BR:alim03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   106534412
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 106534412
NCBI-ProteinID: XP_013886492
UniProt: A0A2I4D2L8
LinkDB
Position
Unknown
AA seq 771 aa
MDQGGVKKITYRGNDHLSKLVYTESPEEGGLLKVAPHSAVSLASATSVVLPTSPLMQPGQ
VTNGLSNSPLPDEHTSASAPATIGSLIEIPEPRGLTKDQRPQQPQQFQMHTSNVFGHQSL
PQLEASIVDITQSSMDSLIGGSDPNLFAMKTEDFSLDKGEQDSTDFDNAFDSIGKDVDMT
QKLFNDTSLDLLQEFDLTGSPSDFYVGDDAFLTTLADDSLLGDMRGTLERDIKPALVESI
NTTGALTATPDGSSVTSPRESSSGLSTTSCSTPPTTLPAVVKKEKDTGFIQLCTPGVIKQ
EKTSGGYCQMGATSPISICGVSTSGGQSFHFGINSRNNETLEQKDQKPVPGLFLPVTTIG
GAWNRSPSLGDASPIHRVGELFTTSPTYSNSFTRQEGGAAASTTQGKSGTHKICLVCSDE
ASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMN
LEARKTKKLNRLKGNHSSAPPELTPSLPVETRSIVPKCMPQLVPTMLSLLKAIEPDTIYA
GYDSTLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSF
SLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMAEQFEQMMKISSEFVRLQVSHDEYLCM
KVLLLLSTVPKDGLKSQAVFEEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMH
EMGGGLLSFCFYTFVNKFLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQR
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggatcaaggcggagtgaagaagattacgtacagaggaaatgaccatctgagcaaactg
gtctacactgaaagcccagaggagggaggtcttttaaaagtggcccctcacagcgccgtg
tccctcgcctctgccacgtctgtcgttcttccaaccagcccactaatgcagccaggacag
gtgaccaacggtctcagcaacagcccccttccagatgagcatacctcagcctctgccccc
gccaccataggttccttgatagagatcccagaacccaggggcctgaccaaagatcagagg
cctcagcagccacagcagtttcagatgcacacttccaatgtttttgggcatcaaagcttg
ccccagttggaggccagtatcgtagacattacccagtcctccatggattcgcttatcggg
ggatcagaccccaacttattcgccatgaaaacggaggatttctccctggataaaggagag
caggactccaccgattttgataatgcctttgattctattggtaaagacgtggacatgaca
caaaaactgtttaatgacacgtctctggaccttcttcaggagttcgacctcacaggatcc
ccctcagatttttacgtaggggacgatgcctttctgaccactctggctgatgattcgttg
ctcggggacatgcgagggacattagagagggacataaaacctgctctggtagagagcatt
aacaccactggggcactcactgctacccccgacggcagcagcgtgacgagtccacgcgaa
tccagctcaggcttgtccacgacctcctgttcaacccctccaaccactttgcctgccgtg
gtgaaaaaagagaaagatacgggcttcattcagctctgcaccccaggtgtgattaagcag
gagaaaacttctggagggtattgtcaaatgggggccacgagccccatctccatctgcggg
gtgagcacgtcaggaggacagagcttccattttggaatcaactctcgaaacaacgaaacg
ctagagcaaaaggatcagaagccagtacccggcttgttcctcccagtcacaaccatcggc
ggagcctggaacaggagcccgagcctcggcgacgcctcgcccatccacagggtgggcgag
cttttcacgacctctcccacctactccaacagcttcactagacaggaagggggcgctgct
gcgtccacgacacagggcaagagtggaactcataaaatctgtctggtgtgctctgacgag
gcttcgggctgccattatggagttctcacctgtggcagctgcaaggttttcttcaagaga
gcagtggaaggtcagcataattacctgtgcgctgggaggaacgactgcatcatcgacaag
atcaggcggaagaactgcccggcctgccgcttccgcaagtgtctgatggctggaatgaac
ctggaagctcgcaaaaccaagaagttgaatcgcctaaagggcaaccacagcagcgcgccg
cccgagctgacgccgtcgctgcccgtcgagacgcgttccatcgtccccaagtgcatgccg
cagctcgtgcccaccatgctgtccctgctgaaggccatcgagccggacaccatctacgcc
ggctacgacagcaccctgcccgacacctccacccgcctcatgaccaccctgaacaggctg
ggggggcggcaggtcatctctgccgtgaagtgggccaaggctctgccaggtttcaggaac
ctgcacctggatgaccagatgacactgctgcagtgctcctggcttttcctcatgtctttc
agtctcggctggaggtcctaccaacagtgcaatggcaacatgctctgcttcgccccggac
ctcgtcatcaacgaagagcggatgaagctgccctacatggccgagcagtttgagcagatg
atgaagatttccagcgagttcgtccggctgcaggtttcccacgacgagtacctgtgcatg
aaggtcctgctgctgctcagcacagtgccgaaggacggcctgaagagtcaggcggtgttc
gaggagatccgcatgtcgtacattaaggagctggggaaagccatcgtgaagcgcgaggag
aactccagccagaactggcagcggttctaccagctcaccaagctgctggactccatgcac
gagatgggcggcggtctgctcagcttctgcttctacaccttcgtgaacaagttcctgagc
gtggagttccccgagatgctggcagagatcatcagcaatcagttaccaaaattcaaggct
gggagcgtcaaacctctcctcttccatcagagatga

DBGET integrated database retrieval system