KEGG   Austrofundulus limnaeus (annual killifish): 106534413
Entry
106534413         CDS       T06063                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim04010  MAPK signaling pathway
alim04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:alim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106534413 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106534413 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:alim04052]
    106534413 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:alim00536]
    106534413 (fgf1)
Cytokines and growth factors [BR:alim04052]
 Growth factors
  Growth factors (RTK binding)
   106534413 (fgf1)
Glycosaminoglycan binding proteins [BR:alim00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106534413 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 106534413
NCBI-ProteinID: XP_013886493
UniProt: A0A2I4D2N6
LinkDB
Position
Unknown
AA seq 158 aa
MADGEILGAGEEFEEGGGLALRDYRRLTRLYCMNGGYHLQILPDGTVQGGRNEQDLHAVL
KLRSVDRGVVVIQGTEAGRYLAMSDEGHLYSSPTVTDECYFLEKLEENHYNTYKSQKYED
HTWYVALKKNGKPKPGPRTHIGQKAIFFLPRQLDDPRY
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcggacggagaaatactgggagccggggaagagtttgaggagggcggtggccttgcg
ctgcgggactaccggcggctgacacggctctactgcatgaacggcgggtatcacctccag
atcctccccgatgggacggtgcagggcggaaggaacgagcaggaccttcacgctgtttta
aagctcagatctgtggacagaggtgtcgtggtcatccagggaacagaagcggggcgatat
ttggccatgagcgatgaagggcacttgtacagctcgcccacagtgacggatgaatgctac
ttcctggagaagctggaggagaaccactacaacacgtataagtcacagaaatatgaagac
cacacttggtacgtagccctgaagaaaaacggcaaacctaagcccggtccaagaacccac
atcggacagaaggccatcttctttctgcccagacagctggacgacccccggtactga

DBGET integrated database retrieval system