KEGG   Austrofundulus limnaeus (annual killifish): 106536910Help
Entry
106536910         CDS       T06063                                 

Gene name
ercc5
Definition
(RefSeq) DNA repair protein complementing XP-G cells
  KO
K10846  DNA excision repair protein ERCC-5
Organism
alim  Austrofundulus limnaeus (annual killifish)
Pathway
alim03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:alim00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    106536910 (ercc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:alim03400]
    106536910 (ercc5)
DNA repair and recombination proteins [BR:alim03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106536910 (ercc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 106536910
NCBI-ProteinID: XP_013889706
UniProt: A0A2I4DBT9
LinkDB All DBs
Position
Unknown
AA seq 1067 aa AA seqDB search
MGVHGLWRLLESTGKPINPETLEGKILAVDISIWLNQAVKGVRDRQGNSVQNAHLLTLFH
RVCKLLFFRIRPVFVFDGDAPLLKKQTLALRRQRKEELTRESKQTNEKLLKTFLKRQAIK
AALGDQSKDPLPSISGVRRNEVDDMYILPALPPAEEKERSSSEEEEEKEGNELSDSYHMY
QEELYEDPNSVDINSEEFSSLPAEMKHEILKEMKDFCKRRRTMIHKPPERSGEFSQYQLA
GLLQRNRLNQRLEGVEREMSHRSAAGAPQLGQEDGDQRSHSVESNRLVSEDHSHYILIKG
SKKSEAASESQPAASPWAGSSLSGCRRAADKPKPLWRPVAEEEEEVQASSSKETSESKPL
QEDACPASPRTLEAIQAALNDCSDDDDEEEDGRVSPRTLLAIQQALTEEEDGTSISPAKP
RTSPPRPVVIGSSDEESRPVPEESSDFPTNAAQSVHMEDSLLDSSSEEELEEVVEQRNKA
FRLAALPRAEEEEEERTREAEEREELKEKASNQNSPNVSPSSRTSWNPGGTETNAPPGNP
EEKSAEETNGDKVKMDSGSEESFIEVPEEEVEEEDAADSDAVGDKRSSEEADKDVTITDD
ESGGSLTEVLQGPTTAXSSEEEKEEESETQNQENELKEGTEADSKTTGTSEWDHIDVGEL
EALESSLGLEQDSLTEQKQQQERMANTVTGQMYLESQELLRLFGVPFLVAPMEAEAQCAA
LDRADQTHGTITDDSDVWLFGGRHVFKNFFSQNKYVEHYQFSDLQSQLGLDRTKLINLAY
LLGSDYTEGVPGVGYVTGMEILNEFPGPALEPLIQFSQWWSEAQENKRLVADPRDTKVKK
KLRDLKVQPGFPNPAVAQAYLEPVVDQSDASFSWGLPQLDMMKEFCLSRFGWSSRKTEEI
LQPVIKQLNSQQTQLRIDSFFRLEQQEKQSIRSQRLRRAVTCLKRKERGGGGGEDEGSEE
EIKSKKTSVKTTERQKEDVRSAAGGGFLGSELTDEPPLLPLKDICGSGPDSGGRSIKTRP
EKTRSSSSSSSDDDDDKKAAMVTARSVFEGSKRGRGGKRPRGKGKKH
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcacggactgtggaggctgctggagagcacagggaaacccatcaatcctgag
actctggagggaaagatccttgctgttgacatcagcatctggttaaaccaagcagtgaag
ggggtgagggaccgccagggcaacagtgtccagaacgcccatctcctcactctcttccac
cgcgtctgtaagctgctcttcttccgcatcagaccggtctttgtgttcgacggagatgct
cctctgctgaaaaaacagaccctggctctgaggaggcagaggaaggaggagctgacccgc
gagtccaaacaaaccaacgagaaactcctcaagaccttcctgaagagacaagccatcaaa
gctgcccttggagatcaaagcaaggaccctctgcccagcatctcaggcgtcaggaggaac
gaggtggacgacatgtacattctgcccgcccttccacctgcagaggagaaggagagaagc
agctcagaggaagaagaggagaaagaaggaaacgagttgagtgacagttatcacatgtat
caggaagaactgtacgaagacccaaactctgtggacatcaactccgaggagttctccagc
ctgcccgccgagatgaaacacgagatcctgaaagaaatgaaggacttctgtaaaagacgc
aggaccatgattcacaaacctccagagcgctcaggagagttttctcagtaccagctggcc
ggcctgctgcagaggaaccggctgaaccagcgcctggagggggtggagcgagagatgagc
caccgcagcgccgccggcgcgccacagctcggccaggaggacggagaccagcggagtcac
agcgtggagtcaaaccgactggtttcagaagaccactcgcattacattctcattaaaggc
tccaaaaagtctgaagctgcctcagagagccagcctgcagcctcgccctgggccgggagc
tccctgtccggctgcaggagagcggcagacaaacccaaacctttgtggcgacctgtcgct
gaggaagaggaggaggtacaggcctcttcgtcaaaggagacctctgagtcaaaaccactt
caggaagacgcctgtccagcttcacctcggactctggaggccatccaggctgccctgaac
gattgctccgatgatgatgatgaagaggaggatggacgggtatctcctcgtacgctcctg
gcaatccagcaagctttaaccgaggaagaggacgggacaagcatctcacctgccaaaccg
aggacaagtcctcctcgtcccgtggtcattggcagctcagacgaggagagccggcctgtc
cctgaagaatcgtcagattttccaacgaatgccgcccagagcgtccacatggaggacagc
ctgctcgacagcagctctgaggaggagctggaggaagtggtcgaacagagaaacaaagcc
tttcgattggctgcgctgccacgagcygaggaggaggaggaggagcggacgagagaggcg
gaggaacgggaggagctgaaggagaaagcgtccaatcagaactcaccgaatgttagtccc
tcctctcggacaagttggaacccaggcggcacagaaacaaacgctcctcctggaaacccg
gaggagaagagtgccgaagagacgaacggagacaaggtgaaaatggacagcgggtctgaa
gagagtttcatcgaggtgccagaagaggaagtcgaagaggaggacgcagctgattcagac
gctgttggagacaaaagatcttcagaagaagccgataaagacgtgacgattacagacgac
gagtcgggtggaagtttaaccgaggttctccagggtccaactactgctrggagttcagag
gaggaaaaagaggaggaatcagagactcaaaatcaagagaacgagctgaaagagggaaca
gaggcagactctaaaacaacaggaaccagtgagtgggaccacatcgacgtgggtgaactg
gaggctctggagagctcgttagggttggagcaggacagcctgacggagcagaaacagcag
caggaacgaatggcgaacaccgtcaccggacagatgtacctggaaagtcaggagctgctg
cggctgttcggcgtgccgttcctggtggcgccaatggaggccgaagctcagtgcgcggcg
ctggaccgcgccgaccagacgcacgggaccatcacggacgactcggacgtgtggctgttc
ggaggaagacacgtgttcaagaacttcttcagccagaacaaatacgtggagcactaccag
ttcagtgacctgcagagccagctgggtctggacagaactaaattaataaatctggcctac
ctgctcggcagcgattacactgaaggtgtaccgggagtcggatatgtgacgggcatggag
atcctgaacgagtttccaggtccagctttggagccactaatacagttcagtcagtggtgg
tcagaggctcaggagaacaaacggctggtggctgatccccgagacaccaaggtgaagaag
aaactccgggatctgaaggtccaacctggcttcccgaacccggccgtggcccaggcgtac
ctggaacctgttgtggatcagtcagacgcctcgttcagctggggactcccccaactggac
atgatgaaagagttctgcctgagtcgattcggttggagcagccgaaagacggaggagatc
cttcaacctgtgatcaaacagctgaacagccagcagactcagctgagaatagactccttc
ttccgcctggagcagcaggagaagcaatcgattcgcagccagcgactccgccgagccgtc
acctgcttaaagaggaaggagagaggaggaggaggaggagaggacgaaggcagcgaggag
gaaatcaagtctaagaaaacaagcgtgaagaccacagagaggcagaaagaagatgtcaga
tccgcggcaggcggggggtttctaggttctgagctcacagatgaacctcctcttctgcca
ctgaaggacatctgcggttctggtccggattctggcggtcggtccatcaagactcggcct
gagaagaccaggagcagcagcagcagctccagtgatgatgatgatgataagaaagctgcc
atggttacggcccgatccgttttcgagggcagcaaacgaggtcgtggaggaaaacgaccg
agaggaaaaggaaagaagcattaa

DBGET integrated database retrieval system