KEGG   Alloactinosynnema sp. L-07: CRK55933Help
Entry
CRK55933          CDS       T04489                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
all  Alloactinosynnema sp. L-07
Pathway
all00410  beta-Alanine metabolism
all00640  Propanoate metabolism
all00650  Butanoate metabolism
all01100  Metabolic pathways
all01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:all00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CRK55933
   00650 Butanoate metabolism
    CRK55933
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CRK55933
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRK55933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:all01007]
    CRK55933
Enzymes [BR:all01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CRK55933
Amino acid related enzymes [BR:all01007]
 Aminotransferase (transaminase)
  Class III
   CRK55933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CRK55933
UniProt: A0A0H5CF96
LinkDB All DBs
Position
I:918344..919702
Genome map
AA seq 452 aa AA seqDB search
MVSTLSTDHTRGMADTQQTPLIDRHRAVLPSWLALYYADPIELVSAEGRHVTDADGKTYL
DFFAGILTNAIGYDIAEISDAIRRQLDSGVLHTSTLYLIRGQVELAEKIAKLSGIPDAKV
FFTNSGTEANETALMLSTQFRRSNQVLALRNSYHGRAFGTVGITGNRGWSASSLSPVKVS
YVHGGYRYRSPFGHLSDADYIQACADDLREVLNTTTSGDVACMIAEPIQGVGGFCVPPDG
LYKAFKEILDESGILLVSDEVQTGWGRTGEHFWGIQAHGVTPDMMTFAKGLGNGLAIGGL
VARPDVMDCLTANSISTFGGNPIATAGANAVIDYLLDNDLQANAEKQGIRLSEGLHDIAH
RHPVVGDVRGKGLMIGVELVEPGGKAPNPTAAVRVLEETKARGLLVGKGGLHNNVIRLAP
PMTLTEHEVDEALDVLSEAIAVADAAAQGGEG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgacgctgtccaccgaccacactcgcggcatggccgacacccagcagacgccg
ctgatcgaccgtcaccgagcggtcctaccgtcctggctcgcgctctactacgccgacccg
atcgagctggtgagtgccgagggcaggcatgtcaccgacgccgacgggaagacctatctc
gacttcttcgccggaatcctgaccaacgccatcggctacgacatcgccgagatcagcgac
gcgatccggcgtcagctcgactcgggggtcctgcacacctcgacgctctacctcatccgc
ggccaggtggagttggccgagaagatcgccaagctgtccggcatcccggacgcgaaggtg
ttcttcaccaactccggcaccgaggccaacgagaccgcgctcatgctgtcgacccagttc
cgtcgcagcaaccaggtcctcgcgctgcgcaactcctaccacgggcgcgcgttcggcacg
gtcggcatcaccggcaaccggggctggtcggccagcagcctgtcgccggtcaaggtcagc
tacgtccacggcggctaccgctaccgcagccccttcggccacctcagcgacgccgactac
atccaggcctgcgccgacgacctgcgcgaggtcctcaacaccacgacctccggcgacgtc
gcgtgcatgatcgccgagccgatccagggggtcggcgggttctgcgtgccaccggacggg
ctctacaaggcgttcaaggagatcctggacgagagcgggatcctgctggtctccgacgag
gtgcagaccgggtggggccgcacgggcgagcacttctggggcatccaggcccacggcgtc
acgccggacatgatgactttcgccaaggggctgggcaacggcctggccatcggcgggctg
gtcgcgcggccggacgtcatggactgcctgaccgccaactcgatctccaccttcggcggc
aacccgatcgccacggcaggcgcgaacgccgtgatcgactacctgctggacaacgacctg
caggccaacgccgagaagcagggaatccggctgtccgagggactgcacgacatcgcccac
cggcacccggtggtcggcgacgtgcgcggcaagggcctgatgatcggcgtcgagctggtc
gagcccggcggtaaggcccccaacccgacggccgcggtgcgcgtgctggaggagaccaag
gcgcgtgggctgctggtcggcaagggcggcctgcacaacaacgtcatccggctcgcgccg
ccgatgacactgaccgagcatgaagtcgacgaagcgctcgacgtcctcagcgaagcgatc
gctgtcgcggacgccgcagcgcagggtggtgagggctga

DBGET integrated database retrieval system