KEGG   Alloactinosynnema sp. L-07: CRK56629Help
Entry
CRK56629          CDS       T04489                                 

Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
all  Alloactinosynnema sp. L-07
Pathway
all00511  Other glycan degradation
all00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:all00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CRK56629
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CRK56629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:all02042]
    CRK56629
Enzymes [BR:all01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CRK56629
Bacterial toxins [BR:all02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CRK56629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 NPCBM_assoc Sortilin-Vps10 DUF5060
Motif
Other DBs
NCBI-ProteinID: CRK56629
UniProt: A0A0H5CGR5
LinkDB All DBs
Position
I:1625966..1628233
Genome map
AA seq 755 aa AA seqDB search
MRGAAVISLIVVLLAGGGPPAAVAGPADPPGVFTQQNLGATMVAPFASYRIPALAHLGGG
VLVAAWDGRPGSAADAPNPNSIVVRRSTDNGATWTAQATALAGHTGTGKYGYSDPSLVHD
AETGDLFMFSVYSKDTGVFDSAWGNDDANRLVLSAQVAKSSDQGVTWSAPRLITNVVKPG
ANPAAPVPGDVRGTFATSGEGIQLKYGPHKGRLLQQFAGHVRQADGSNQWQAYSVYSDDH
GATWRMGTPVGTAMDENKVVELSNGDVLMNSRDNAGGGYRKTAVSTDGGQSYGPVSQDRE
LPDPTNNASITRLFPDAPQGSADARKLLFTNSNSQTSRVNGSARVSCDDGASWTSVRSFA
PGFAAYSTATRLDSGLIGVLYETSYTTGITFARFDDAWLNHLCAPMTIADATVQAGASVS
IPVTVVNQTDASLSATAAITPPAGWTASAPVPVTAAAGASTIATITLTAPKNATVGAHRV
LVTTTAADGRQSQREFTVTALPSAGVVVIDGVRLFGQRTDTARDLTANPYTAGEVVTYRF
TGTNTGTTTVSVYPTSGNFDAPFAPPGTGNCRYSALAAGATYTCSTAKHTVTAADVAAGY
FVPDSAWRVDRGTANATGRIVGVPVPLRGGVLTGVGDIAGVTVTGARTDTRDYVANPYTA
GETVGYNCQVHNTGAVTVSVVPTASNIARTVPPGAGNCRHTALAPGAGYTSATPYRVLTA
ADVAQGYFIPDTTWSVIAASTTTTRRVLGDPVLVR
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcgctgccgtgatttcgctgatcgttgtcctgttggctgggggtgggccgccc
gccgctgtggccgggcccgcggatccgccgggtgtgttcacccagcagaacctcggcgcg
acgatggtggcgccgttcgcctcctaccggatccccgcgctcgcgcacctcggtggcggc
gtgctcgtcgccgcgtgggatggcaggccgggcagtgccgccgacgcgcccaatccgaat
tccatcgtggttcgccgcagcactgacaacggcgccacctggaccgcccaggccaccgcg
ctcgccgggcacaccgggaccgggaagtacggctacagcgaccccagcctcgtgcatgac
gcggagaccggtgacctgttcatgttctccgtgtactccaaggacaccggcgtgttcgac
agcgcatggggcaacgacgacgcgaaccgcttggtgctcagcgcgcaggtcgccaagtcc
agcgaccagggtgtcacctggagtgccccacggctgatcacgaacgtggtcaagccgggc
gcgaacccggccgccccggtgccaggtgacgtgcgcggcaccttcgccacctccggcgag
ggcatccagctcaagtacgggccgcacaagggacggctcctccagcagttcgccgggcac
gtgcggcaggccgacggctcaaaccagtggcaggcctacagcgtgtactccgacgaccat
ggcgccacctggcggatggggaccccggtcggcaccgccatggacgagaacaaggtcgtc
gaactgtcgaatggcgatgtgctcatgaactcgcgggacaacgcgggcggcgggtaccgc
aagaccgctgtctccaccgatggcggccagagctacggcccggtgagccaggatcgcgag
ctgccagacccgaccaacaacgcgtccatcacccgtctcttcccggacgctccccagggc
agcgcggacgcgcggaagctgttgttcaccaacagcaacagccagaccagccgggtcaac
ggctcggccagggtgtcgtgcgacgacggcgccagttggacgtcggtgcgctcgttcgca
cccggcttcgcggcctactccaccgccacccggctcgacagcggcctgatcggcgtgctc
tacgagacctcgtacaccaccggcatcaccttcgcccgcttcgacgacgcctggctgaac
cacctgtgcgcgccgatgacgatcgcggacgccaccgtgcaggcaggcgcgtcggtgtcg
atcccggtcaccgtggtcaaccagaccgatgcctcgctgtccgccaccgccgcgatcacc
ccgcccgcgggctggaccgcgtccgccccggtcccggtgaccgccgccgcgggggcgtcg
accatcgcgacgatcacgctcaccgcgccgaagaacgccactgtcggcgcgcatcgggtc
ctcgtcactactaccgcggcggacggccgccaatcgcagcgcgagttcaccgtcaccgcg
ctgccgtcggccggggtggtcgtgatcgacggggtccggctgttcggccagcgcaccgac
accgcgcgcgacctgaccgcgaacccatacaccgcgggcgaggtggtgacctatcgcttc
accggcaccaacaccggcacgacgaccgtctcggtgtacccgacgtcgggcaacttcgat
gccccattcgccccgccgggcaccggtaattgccgctactcggcactggccgcgggtgcc
acctacacctgctccaccgccaagcacacggtcaccgcggcggacgtggcggccgggtac
ttcgtgccggactccgcgtggcgcgtcgaccgggggacggcgaacgcgaccgggcggatc
gtcggcgtcccggtgccgctgaggggtggcgtgctgaccggcgtcggtgacatcgccggg
gtgactgtcaccggcgcgcgcaccgacacccgggactacgtggccaacccgtacaccgcg
ggggagaccgtcggctacaactgccaggtccacaacaccggcgcggtcacggtgtcggtg
gtgccgacggcgtcgaacatcgcccgcacggtgccgccgggcgcgggcaactgccgccac
accgccttggccccgggagcgggatacaccagcgcgacgccgtaccgcgtgctgaccgcc
gctgacgtggctcagggttacttcatccccgacaccacgtggtcggtcatcgccgcatca
accaccacgacgcgccgcgtactcggtgacccagtgctggtccgctaa

DBGET integrated database retrieval system