KEGG   Alloactinosynnema sp. L-07: CRK59878Help
Entry
CRK59878          CDS       T04489                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
all  Alloactinosynnema sp. L-07
Pathway
all00020  Citrate cycle (TCA cycle)
all00480  Glutathione metabolism
all01100  Metabolic pathways
all01110  Biosynthesis of secondary metabolites
all01120  Microbial metabolism in diverse environments
all01130  Biosynthesis of antibiotics
all01200  Carbon metabolism
all01210  2-Oxocarboxylic acid metabolism
all01230  Biosynthesis of amino acids
Module
all_M00009  Citrate cycle (TCA cycle, Krebs cycle)
all_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:all00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRK59878
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CRK59878
Enzymes [BR:all01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CRK59878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CRK59878
UniProt: A0A0H5CPZ5
LinkDB All DBs
Position
I:complement(5070617..5071837)
Genome map
AA seq 406 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLAYYDLGIEHRDATDDQVTIDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGAGELTMTFTPQDGSEPIQHVVANYGPDGGVAM
GMYNFNKSIEDFARASFAYGLNRNYPVYMSTKNTILKAYDGSFKDIFQNVFDTEFKAEFD
AKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTGGLKHRGKLDGTPEVIGFADALE
NVIIETVESGRMTKDLAALVGPDQEWQTTEDFLGTLDENLQKKMAG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggaacggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtcaacctggcg
tactacgacctgggcatcgagcaccgcgatgccaccgacgaccaggtgaccatcgacgcc
gccaacgccatcaaggagcacggcgtcggcgtgaagtgcgcgaccatcaccccggacgag
gctcgggtcgaggagttcggcctcaagaagatgtgggtctcgcccaacggcacgatccgc
aacatcctcggcggcgtggtgttccgcgagccgatcatcatctccaacatcccgcgcctg
gtgcccggctggaccaagccgatcatcatcggccgtcacgcccacggcgaccagtacaag
gccaccaacttcaaggtgcccggcgccggtgagctgaccatgaccttcaccccgcaggac
ggctccgagccgatccagcacgtcgtggccaactacggccccgacggcggtgtggcgatg
ggcatgtacaacttcaacaagtccatcgaggacttcgcccgcgcgtccttcgcctacggc
ctgaaccggaactacccggtctacatgtcgacgaagaacacgatcctcaaggcctacgac
ggctcgttcaaggacatcttccagaacgtgttcgacaccgagttcaaggccgagttcgac
gccaagggcctgacctacgagcaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtcgcgcagggcttcggctcgctgggcctgatgacctcggtgctgatgaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcacggtcacccggcactaccgccagcaccag
gcgggcaagccgacctcgaccaacccgatcgcgtcgatcttcgcgtggaccggcggcctc
aagcaccgcggcaagctggacggcacccccgaggtgatcggcttcgccgacgcgctggag
aacgtcatcatcgagaccgtcgagagcggccggatgaccaaggacctcgccgcgctggtc
ggcccggaccaggaatggcagaccaccgaggacttcctcggcacgctcgacgagaacctg
cagaagaagatggcgggctga

DBGET integrated database retrieval system