KEGG   Alloactinosynnema sp. L-07: CRK60827Help
Entry
CRK60827          CDS       T04489                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
all  Alloactinosynnema sp. L-07
Pathway
all03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:all00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CRK60827
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:all03400]
    CRK60827
Enzymes [BR:all01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CRK60827
DNA repair and recombination proteins [BR:all03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CRK60827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: CRK60827
UniProt: A0A0H5CRN8
LinkDB All DBs
Position
I:complement(5964149..5965063)
Genome map
AA seq 304 aa AA seqDB search
MADDVMVAVEGRRIKLSNLDKVFYPGADFTKGEVINYYSRIAPALLPHLAERPMTFRRFP
DGVTKAGFFEKNASRHAPSWVRTVTIETPGSSTGAESLDFAVLGDLASLVWAANLAGLEL
HVPQWTIGARGAARRPDRLVFDLDPGEPATIVECCEVALRLREVLADDGLTAVAKTSGSK
GMQLYAAVTTTSAEQTSDYAKRLAEQLEAELPRLVVSRMAKDLRRHKVFIDWSQNNPNKT
TIAPYSLRARPAPTVSTPVTWDEVAACRSVDDLTFIADEVLDRVDDHGDLFEVLLTKGPR
LPRG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgatgtgatggtggccgtcgagggtcggcggatcaaactgtccaatttggac
aaggtattctaccccggtgccgacttcaccaagggtgaagtgatcaactactacagccgg
atcgcgcccgcgctgctaccgcacctcgccgagcggccgatgacgttccgccggttcccg
gacggggtgaccaaggcgggcttcttcgagaagaacgcctcgcggcacgcgccgtcgtgg
gtccgcacggtgacgatcgagacgccgggcagcagcaccggcgcggagagcctggacttc
gcggtgctgggcgacctggcctccctggtgtgggcggccaacctggccgggctggagctg
cacgttccacaatggacaatcggcgcgcgcggcgcggcccggcggcccgaccggctggtg
ttcgacctcgacccaggcgagcccgccacgatcgtcgaatgctgcgaggtcgcgctgcgg
ctgcgcgaggtgctggccgacgacgggctgacggcggtggccaagacgagcggctccaag
gggatgcagctctacgcggcggtgaccacgacgtcggccgagcagacctcggactacgcc
aagcggctggccgaacaactggaggcggaactgccgcgactggtggtctcgcgcatggcc
aaggacctgcggcggcacaaggtgttcatcgactggagccagaacaacccgaacaagacc
accatcgcgccgtactcgctgcgcgcgcggccggccccgactgtgtcgaccccggtgacg
tgggacgaggtcgcggcgtgccgctcggtggacgacctgacattcatcgccgacgaggtg
cttgaccgggtcgacgaccacggcgacctgttcgaggtgctgttgaccaaggggccgagg
ctgcctagaggctga

DBGET integrated database retrieval system