KEGG   Algoriphagus sp. M8-2: AO498_00570Help
Entry
AO498_00570       CDS       T04334                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00010  Glycolysis / Gluconeogenesis
alm00053  Ascorbate and aldarate metabolism
alm00071  Fatty acid degradation
alm00280  Valine, leucine and isoleucine degradation
alm00310  Lysine degradation
alm00330  Arginine and proline metabolism
alm00340  Histidine metabolism
alm00380  Tryptophan metabolism
alm00410  beta-Alanine metabolism
alm00561  Glycerolipid metabolism
alm00620  Pyruvate metabolism
alm00625  Chloroalkane and chloroalkene degradation
alm01100  Metabolic pathways
alm01110  Biosynthesis of secondary metabolites
alm01120  Microbial metabolism in diverse environments
alm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO498_00570
   00053 Ascorbate and aldarate metabolism
    AO498_00570
   00620 Pyruvate metabolism
    AO498_00570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AO498_00570
   00561 Glycerolipid metabolism
    AO498_00570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AO498_00570
   00310 Lysine degradation
    AO498_00570
   00330 Arginine and proline metabolism
    AO498_00570
   00340 Histidine metabolism
    AO498_00570
   00380 Tryptophan metabolism
    AO498_00570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AO498_00570
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AO498_00570
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AO498_00570
Enzymes [BR:alm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AO498_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMQ54864
UniProt: A0A142EIA9
LinkDB All DBs
Position
complement(119533..121077)
Genome map
AA seq 514 aa AA seqDB search
MSSNFGIQESLNRLGISSQNPGTSTGQVWINSQSNYLASYSPVDGKKIAEIQVTDNDGYE
AVVSKSQQAFEIWRQVPAPRRGEIVREIGNALREVKADLGKLVSYEMGKSYQEGLGEVQE
MIDICDFAVGLSRQLYGLTMHSERPGHRMYEQWHPLGIVGIISAFNFPVAVWSWNAAIAW
VCGDVCIWKPSEKAPLSALACQKIVAPIFEKHGMPEGISSLIVGDYQVGEWMTQDSRVPL
ISATGSTRMGKIVGKTVAERLGRSLLELGGNNAIVISEHADLDMAIRGALFGAVGTAGQR
CTSTRRLIIQENVYEEVKSRLASAYSKLVIGNPLDETNHVGPLIDRDAVNAYLSAIEKVK
ASGGKAVVAGGVLEGEGFESGCYVLPAIYEAENHFEIVQHETFAPILYLIKYKILPEAIA
LHNGVPQGLSSAIMTLNMREAEAFLSHVGSDCGIANVNIGTSGAEIGGAFGGEKETGGGR
ESGSDAWKAYMRRQTNTINYSTALPLAQGIKFDI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaatttcggaattcaggaatccctaaaccgattggggatttcttcccaaaat
ccaggaacctccaccggtcaggtgtggatcaattctcaatccaactatttggcatcttat
tcaccagttgatgggaaaaagatcgctgaaattcaagtaacggacaatgatggctatgag
gcggtggtttccaaatcccagcaagccttcgaaatctggcgacaggtgcctgctcctcgt
cgaggggaaattgttcgtgaaattggtaacgctcttcgagaggtcaaagccgatttggga
aagcttgtttcttatgaaatggggaaatcctaccaagaaggactcggggaagttcaggaa
atgatcgatatctgtgattttgcggttggactttccagacagttgtatggattgacgatg
cattctgagcgacccggccaccggatgtatgagcagtggcatccacttggcatcgtagga
attatttctgcctttaattttccagttgcggtttggtcttggaatgctgccattgcttgg
gtatgtggggatgtctgtatatggaaaccctccgaaaaggcgcctctgtctgccttggct
tgtcaaaaaattgtagcgcctatttttgaaaaacacggaatgcctgagggaatctcctct
ctgattgtgggagattaccaagtaggagaatggatgactcaagattcacgagttcctttg
atttctgctacaggatccacccgaatgggaaaaattgtgggtaaaactgtcgccgagcga
ttgggaagatcccttttagaattgggaggcaataatgctattgtgatctctgagcatgcc
gatttggatatggcaattcgcggagctttgtttggtgcggtagggacagccggacagcgt
tgtacctcaacccgcagattgatcattcaggaaaatgtctacgaagaagtaaaatccaga
ttagcatctgcttattccaaattagtcattggtaatccgctggatgagactaatcatgtg
gggccattgattgatcgggatgcagtcaatgcatatttatccgctatcgaaaaggtcaaa
gcttctggtggcaaggccgtagtagcaggaggggtcttagaaggcgaaggctttgaatca
ggatgttatgtgcttccagctatttacgaagctgaaaatcacttcgagattgtgcagcat
gaaacttttgcccctattctctatctcattaaatataaaatcctgcctgaagcgatcgct
cttcacaatggagtgcctcaaggactctcctccgcgattatgaccttgaatatgagggag
gcagaagctttcttatcgcatgtcggctcggattgtggcattgccaatgtcaatatcgga
acgtcaggagctgaaattgggggtgcatttggtggtgaaaaggaaactggcggagggcgt
gagtcaggctcggatgcttggaaagcctacatgcggagacaaaccaatacgattaattac
tccacagctttgccactcgctcaaggaatcaaatttgacatttaa

DBGET integrated database retrieval system