KEGG   Algoriphagus sp. M8-2: AO498_02025Help
Entry
AO498_02025       CDS       T04334                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
alm  Algoriphagus sp. M8-2
Brite
Enzymes [BR:alm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AO498_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMQ55156
UniProt: A0A142EJ51
LinkDB All DBs
Position
complement(466960..467565)
Genome map
AA seq 201 aa AA seqDB search
MAFTLPALPYAFDALEPHFDARTMEIHHGKHHNAYVTNLNNAIAGTELEGKSLEELMTVA
GSNTAVRNNGGGHWNHSLFWQILSPNGGGAPTGELAAAIDAKFGSFDAFKETFNKAAATR
FGSGWAWLCVDAKKELCVCSSPNQDNPLMDVAECPGTPIMGLDVWEHAYYLHYQNRRPDY
ISAFWNVVNWEEVSKRYAAVK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttttacacttcctgccttaccgtatgcatttgatgccttggaacctcattttgac
gcaagaaccatggagattcaccatggaaagcatcacaatgcatatgtgaccaatctaaat
aatgccattgctggcaccgaactagaaggaaaatctttagaagaattgatgaccgtagca
ggttcaaacactgcagttagaaataacggcgggggtcactggaaccatagccttttttgg
cagattctttctccaaacggcggtggagcgcctactggtgaattggcagcagctattgat
gcaaaatttggatcttttgatgccttcaaagagactttcaacaaggcagcagcaactcgt
tttggttcaggttgggcttggttgtgtgtagatgctaaaaaagaactttgtgtttgctct
tctccaaatcaagataatccattgatggatgtagcggaatgtccaggtactccaattatg
ggattggacgtgtgggagcatgcgtattacctacattatcaaaacagaagaccagattat
atttcagcattctggaatgtggttaactgggaggaagtgagcaagcgttacgctgccgtt
aaataa

DBGET integrated database retrieval system